KEGG   Acropora digitifera (stony coral): 107335768Help
Entry
107335768         CDS       T04352                                 

Definition
(RefSeq) beta-2 adrenergic receptor-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:adf00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107335768
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:adf04030]
    107335768
G protein-coupled receptors [BR:adf04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107335768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 107335768
NCBI-ProteinID: XP_015756284
Position
Un
AA seq 358 aa AA seqDB search
MNFSHTNLSTSLVGYTSQGPAFRSFSAAIYGTIISVAFVGNLLACLAFVVSPLVRRPPTN
HFILSLAVGDLLTVCFAVPFDLEQTIKNIWSHGEVLCLVWTTSYLLTVPSSIWSLLALSV
DRYKSLKDPLNRFRQTPFMTRKRAGLVILFLWVYSGIFALLPVMGWKRIPRSVHDNFCDF
NITIEYSLLSSIINFVLPTTFMCVLYWSIYKIARGVARDATLLQLGNSSSSRGREAKKIK
KRIKTTKKILVVAWTFFFCWMPHTLVSIAFVFLHKWCGPKCLGAIPSEIYTILLMLGYSS
SALNPYLYALRNKQFRKALLNIVPAVRRRFSYWPTLTSLGDRLTTRFYDRGTTASTSV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcccatacgaatctttcgacttcgcttgttggttacacatcacaaggtcct
gcgttcaggtctttctccgcagcgatttatggcactataatctctgtcgcttttgtcgga
aatttgttggcctgcctggcatttgttgtaagtccattagtacgcagacccccaacaaat
catttcatcctctcgttggcagttggggaccttcttacagtttgctttgcggttccattt
gatttagaacaaactattaagaacatttggagccatggagaagtgctctgtctggtatgg
acaacatcgtacctgctgactgtgccctcgtccatatggagcctattagcgcttagcgtt
gaccgatataagagccttaaggatccgcttaaccgttttcgccaaacgccatttatgacg
cgaaaacgtgcaggcctcgtgatcttatttctgtgggtttattcagggatctttgctctt
ttgcccgtaatgggttggaaaagaattcctcgaagcgtccacgacaacttttgcgacttc
aacattacaattgaatattccttactgagttctataatcaattttgttttgcccaccacc
ttcatgtgcgtgctgtattggagtatctataaaattgcccgtggtgttgcgcgagacgcc
accttacttcagctcggcaactcttcgtcctccagaggaagagaggccaagaagataaaa
aagcgcattaaaacaacaaagaagattctcgttgtggcttggacgttctttttctgctgg
atgcctcacacactcgtcagcattgcttttgtctttttgcacaagtggtgcggtccgaaa
tgtctaggggcgattccaagtgagatctacacgattcttcttatgcttgggtacagcagc
tctgcgttgaatccttacttgtatgccctgagaaacaaacagtttaggaaagccttactg
aatatcgtgccagccgtcagacgcagattttcttactggcctacattaacctctctggga
gatcgtctaaccactcgcttttatgatcggggcacaactgcaagcacatcggtgtaa

DBGET integrated database retrieval system