KEGG   Acropora digitifera (stony coral): 107336014Help
Entry
107336014         CDS       T04352                                 

Definition
(RefSeq) monoacylglycerol lipase abhd6-A-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:adf01002]
    107336014
Enzymes [BR:adf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107336014
Peptidases [BR:adf01002]
 Serine Peptidases
  Family S33
   107336014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 UPF0227 FSH1 DLH Ndr Abhydrolase_3 Thioesterase Asp2
Motif
Other DBs
NCBI-GeneID: 107336014
NCBI-ProteinID: XP_015756560
Position
Un
AA seq 257 aa AA seqDB search
MVHGFSGDKGVWCRMGDVFPSTYHLIAVDLPGHGYTTRKYHDDHSILALVAKLHQFVLAV
GLNKRKFHLVGMSMGGFLAGIYAAKYSSLLSSLVLICPAGVKAPRLSEYIMEVANGRKNY
LLPKNPDDFRFMLKKISHRDVFIPSFVINIMSAARQSAHEFYEKVMAELSHPDQRFLLEK
FLEDINVPTLTLWGDKDKILDRSAVDIIAEKVKNCKIEIVDNCGHAIVFERPFRSAKLIL
QFIHSLPSHGSNWIDRP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggttcacggttttagcggcgacaagggtgtctggtgtcgtatgggcgatgtttttccc
tcgacctatcacttgatagcagtggatctgcctggacatggttatacaacacgtaaatac
cacgacgatcattcgatactggctctagttgcaaaacttcatcagtttgtgttagctgta
ggactgaataaacgaaaattccatctggttggcatgtcgatgggtggtttcttggccggt
atctacgctgctaagtactcctcattgctttcttccttggtcctgatctgtccggcagga
gtaaaagctcctaggctaagtgagtacatcatggaagttgccaacgggagaaaaaactat
ttactgccaaaaaacccggacgatttccgtttcatgttaaagaagatttctcatcgtgac
gtctttataccttccttcgtcatcaatatcatgagcgcagcgagacaatcagcgcatgaa
ttttatgaaaaagttatggctgaactttctcatccggatcagagatttcttcttgagaag
tttttggaagacattaatgttcctactctgaccttgtggggagacaaagataagattctt
gatcgctcagccgtagatatcatcgcagagaaagtaaagaactgcaaaattgaaatcgta
gacaattgcggccatgcaattgtctttgaaagacctttcagatctgcaaagctgatatta
cagtttattcattcgttgccaagccatggatcaaactggattgatcgaccatag

DBGET integrated database retrieval system