KEGG   Acropora digitifera (stony coral): 107339424Help
Entry
107339424         CDS       T04352                                 

Definition
(RefSeq) uncharacterized LOC107339424
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00760  Nicotinate and nicotinamide metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    107339424
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:adf04090]
    107339424
   00536 Glycosaminoglycan binding proteins [BR:adf00536]
    107339424
Enzymes [BR:adf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     107339424
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     107339424
CD molecules [BR:adf04090]
 Proteins
  107339424
Glycosaminoglycan binding proteins [BR:adf00536]
 Hyaluronan
  Cell surface receptors
   107339424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse ISPD_C
Motif
Other DBs
NCBI-GeneID: 107339424
NCBI-ProteinID: XP_015760190
Position
Un
AA seq 369 aa AA seqDB search
MGTWTCSSTLIIAIQTCLVLADSRHHHHHHHKIKKPSSARTWTEQKRGKLPSVYKPIFEW
RKLMNNERDLSLPTEMAWNRRNLSTNRIFEKSYQTSSNQPSDFGNKNYWPIKRYWSNSRN
DIPNYDIPISLYHNPSRAQTFNLWGNAKAKQILQGVAGFRSNIDEDQTTVEERIHEYYDQ
RLNKDRNKWMFKPVQGTTPHLQEIFIGRCWDFVTIKGKYLQDPSKVDCEELWRTFLKSFA
FKGPCDPTFKDFAPFFNLFEEKPLKDRVLFWSGTRELTHTYSRLYDKFTTLEDTLPGFVL
NGLTWCGSNLGSGINFKSCPYECSKQKHFWGQAAAKLAQRARGVVHVMLNGTRQHFVDKQ
IFPAFMDDS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgtggacatgttcatcaacgctgattattgcaatacaaacatgcttggttctt
gcagattccaggcatcatcaccatcatcatcacaagataaagaaaccaagttcagcccga
acatggacagaacaaaagagaggaaagctaccatcagtttacaaacccatttttgaatgg
cgtaaacttatgaataacgaaagagatcttagtttaccaactgaaatggcttggaatcgc
cgaaatttgtcaacaaaccgtatttttgaaaaatcatatcagacctcaagtaatcagcca
tcagatttcggtaacaaaaactattggcccataaaacgttattggtctaactcacggaac
gatattcctaattatgacattcctatcagcttgtatcacaatcccagtagggcacaaacc
ttcaacttatgggggaacgctaaagcgaaacaaattctgcaaggtgtcgctggttttcga
agtaatatcgacgaagaccagacaacagtggaggaaagaatacatgaatattatgaccaa
aggttgaacaaagatcgaaacaagtggatgtttaagcctgttcaaggcacgactccccat
ttgcaagaaatattcattggacgctgttgggattttgtaacaattaaaggaaaatatctt
caagacccgagtaaagttgattgcgaggagttatggagaacatttttgaagagttttgcc
tttaaaggaccttgtgatccaacgttcaaagactttgcacctttcttcaacctgtttgaa
gaaaagcctctcaaagatagggtgctattttggtccggaacaagagagctgacccatacg
tactccagattgtacgataaattcaccacactagaagacactttgccaggattcgtgttg
aatggactgacgtggtgtggaagtaacctggggtctggtatcaactttaagtcttgccct
tacgagtgcagcaaacaaaaacatttctggggccaggcggcagctaagctagctcagaga
gcaagaggtgttgttcacgtcatgttaaacggcacgagacaacactttgtcgacaaacaa
atctttccagcatttatggacgacagttaa

DBGET integrated database retrieval system