KEGG   Acropora digitifera (stony coral): 107339449Help
Entry
107339449         CDS       T04352                                 

Definition
(RefSeq) muscle M-line assembly protein unc-89-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:adf01001]
    107339449
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:adf04131]
    107339449
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:adf04812]
    107339449
   04147 Exosome [BR:adf04147]
    107339449
Enzymes [BR:adf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107339449
Protein kinases [BR:adf01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107339449
Membrane trafficking [BR:adf04131]
 Others
  Actin-binding proteins
   Others
    107339449
Cytoskeleton proteins [BR:adf04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     107339449
Exosome [BR:adf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107339449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set C2-set_2 Ig_6 Receptor_2B4 Ig_4 Izumo-Ig C1-set Adeno_E3_CR1 RhoGEF DUF4198
Motif
Other DBs
NCBI-GeneID: 107339449
NCBI-ProteinID: XP_015760222
Position
Un
AA seq 8016 aa AA seqDB search
MDARWQRFLSRMEDHRTMLEASIEFHQLYEQASVWISDSEHFLKTTQDGAKRCKTEEEVI
DLLDMMEGFVKPGLHKQDARLNKLAELSAKLTMEEPRLKAKGLMVKQKEVAKKFELMDND
LFRLAERLRERKRQGLPPEAEEVNIESIEAYENELAQSAPLSDESEKPVRVNVLSSFIDG
VLGSKRVGDQEVYEEAGPAKRPQVSVRVRSDAPVSFEAEQKIAPIIKSEIQGWFESGKAV
KPVEIPEHEIFVHISEDTKREASEVALAPWGAEVVKKDVTITSLGPFVSKDIEVETALQT
ETTQPSPPDQAQIMRKRIWKTTTRETTTSIKQETRTEVEMLVPEKPEMTSNLYVFGALPP
SENLTVEVRSKKTVESTPDTMEMTSTEEIDRVEREMQAANESICRKIEESLASTRRILQP
NSHAEIVIPQHAGSVLIFTPPGTPRRLSIPCVDSSHVANGHASDHDQPKVESELCLETTP
QGFDFGAIELTIASPCVNGEVLDMKREAALQQMNEITDRLIASEEKYLSDLRSLTENYIY
QLPNAPPEVSDKKETIFVNAEDIFYFHKVVFLKELSKCRGTPSDIGRVFTQRENELDRYI
KYCDGKYDSNNFMESHPTEFFKECEEEASCRPIEELLDRPVERILEYRAYLGDLLECGRK
AGVDTHDLEAAKDVVDRLCAEITQRTQFEILIQEAPKEVELCVTLQDYRDDLNNICLKKG
ETVLVVDRFSRQGMYKVVKFRPDGSRGDEVWIPPYVLQRKRSKAEIVIPAEYSVKLKKAK
PAPKITNQFSEITIPAPEREVVVEMSPVDMAPLPIAPVFTLPLENQKITEGQPTQLDVRV
SGIPEPEIAWIKDGRPVRTGERMHAEKIGDLYSLKISEVDIEDEGIYTCQATNEAGTASS
QADLSVEYKDSRKEQHTVTLSLDRTDGTIFPQLEVQIPKFDDVSASRRRSIPPDFGTELE
DKTIEEGDSVEMQIFVTGTAPVDVIWYKDDQPITLYPHRRFCATRENEICSLEIKDARCS
DQGNYTCVAKNTAGEVRKSCKLFVKQVTPTSPPSFVKHLKDGFIVEGSCTRFDVKITGMP
EPVVSWYKDGLPLDEDKHLEIVHDEDTSALILMYGKLGDAGEYSCEAVNEAGAARSSARL
HVSPIQVPAKFTSTIEDVQVLEGEPLQLKCTFVGKPDPNIIWFKDGEEIHTTSKYKMKLN
PDNTSILDIEKADMDDEGTYTCTAINPAGSDTCSGKLSVNAVGKHPEFIKLLENAEVPDG
CPVRFEVHVQGEPSPSVEWLKGTKILKTGPRFESESNGNVHTFVITNCRDVDSGTYSCKA
QNKFGTATCDATLVVAEDTVPPRFTKKLYDSTADAGNTVEFSVKYIGSPEPNVKWFLDDE
EVSEDDEGMDIETVPGSSLLVLEDIAPNDSGQYKCIITNIAGKAVTSAQLKVVDEGVKGK
PKVPYEIVEVLGPSVETEKVGKPPEFSKKFSSVHVVEGDAVRFEVVVEGTPNPTVHWFVE
NASVKERVQAPYFLRKPTSSRVEEGGSTSIEVQVDGTPVPTVTWYTEENEEIPERGHIRC
LPDGTLVIENAELDDEGFYSCVAGNEAGKVSCKVEVLVDECTSKLQEIVEEIPFSRKLVV
ESELPVAGLLALSREETPPEITKKLQDVSVREGDTARFEVVLAGTMKPDVQWVANNAEIM
ANEETILEANDGTHSLTLMNVILDDEGEYTFTALNDAGKVSCTAKLLVQKNIIKPSFLDS
LRDIEVVENSDVRLEVRVQGTEPDIEWHKNGIAIEEATSRTEFVENEERGTYAYLIYGAT
TKDQGTYRCKAVNTAGEAFCEGKLTVKEQVIPPRFLQRLEDKKVVEGGPVDLDVEISGKP
KPTVRWLKDGEHVAPDNRIQMEVEGRSHTLSISRCRLSDDGKYSCVASNSGGRETCLAIL
KVEEKLRAPQFIAQPEDVQIVEGSQAQFKAVVSGLPEPEIEWFKDGNLIRDSHHFQLEFN
ENKSVLVIKDAKQTDDGEFTCTATNKAGKVSCSVVLVVGETTVAPEFAKTMNGFELCEGD
LVRFEVRVTGTPQPNVQWFRNDKQLGEDKRLDFFTDDDMYSLELPNCLLSDSGMYRCVAS
NEAGQASCSAELIVREKLIPPMFTDQPDFPDRIEEGGSIVLEATVSGKPVPAVQWVKDDT
ALEGSPHIDIKDGDGKHTLIISGAGPKDSGIYKCVANNPAGTSIRTFNVSIEGTKEAIPE
PEITKKLEEVEVLRGQPILLECHVANAADAQVKWFHNDIVVTQDERISVSFNGTVCTLFI
EKSVLDDEGKYMCEIRNDQGMVSSTGEVIVEEGMSLPIFQQKMQNLNVIEGENACFDVRV
TGNPEPVVEWVKDGFQLEDEGRVMIIDDVDENEPELFSLVIENCQHSDTGQYQCLAMNEA
GKAECLAQLLVFPVSDSIRAPDSSDIPLIFSEGQDVTLKALMIKDSVATWVKDDEPIKQS
SHFEVGSAEGVHTLTIKGVTSDDTGIYKCETDANTTSIFNVTIKAKDEMCVKPEVLPATT
AVEVMEGKEAKLSWKVLGTPKPTVTWLKESEPLEIDNRITSVVSEDVYSLCFRETVLDDE
GEYECKAQNDWGTASCALELLVNELEEEPQIKPEFVERMKDLNVSEGDSPSFSVTVKGNP
KPEVQWFTVDKEITTTERFLVDSLIDDRHSLTITDCEIRDKGRYKCVASNAAGKAVCSGI
LTIEEKMISPYFAEQASEVPMQIQEGGDITLKVEVKGKPRPSVKWFKDDKPVSRTSTKYR
TEAQGDNHQLTIVGGTPDDKGTYQCKATSSAGTATRDFHVNIEDETEDKEKGTLVEELVV
VKSSIPVSVKPFGEIQLQLPVKEEDLPSEKKLEYPGQGNAPLIPYTTEYGPVEMVLPVTA
ERILPDFIEVSQDMKVTEGDKVVLKVRVIGQPSPEVTWFIDDETIEAEEGISLQSDGDKH
QLVIDSAHLEDEGVYKCVAKNEAGKAVCEVELLVNEIKGTADESPRGLQITKEIEDLEVD
EGDPATLEVCFVSDAPTTVTWVKDMQPLEEGRRIKIITDDNSSRMIIKKTIGKDEGLYQC
TLQSGERVLSNSAELIVEEPTEDERVNVRKPVLVQKLVDQTVKEGEMLELQIKYIGSKPV
TVTWYRDDEVLHQDDRCKLLSDDDIHLLRVNPVEVDDEAIYKCLVKNQGGQDLCEAKILV
EDKLEEEEISEITDKKPYFVKSLPEEVEVLEGDSSRLECRVAHATEVLWFLENELLEEND
RVTFENDGDVYAVLISPTEVDDEAEYKCVAQNEFGKVSCKTELIVEEGVTMPLIKEPLKN
LDVNVGDVVRFDVRIAGNPEPVVEWFRDGKLLEDEGRFVIIDDVDDSDKELFSLVIEGCE
LEDCGVYKVVAMSEAGTTDCQCDLVVTRATVPPEFKDEMEEVPLEGSQGDNITMSVHTGR
LPAPAIAWFKDEQPIVSNSHLEIIDEPETCKLVVTNITPADSGTYKCVATSIIGTVTKKF
LLNIEGSEEPVTVSDAAELALSIPERPVVDLSAPVFTKKMDDVTVEPGEEARFDARIRGV
PEPNVEWYSGSKKIMDEGRFVHIDAVQEDLFTLIIENVMPSDSGPFRCVATNEAGEMSCE
AHLTVGVTTKSAGIEPEKSVLNVGEGDEVNLNVTFSGTTKPTVEWLKEGKPVRKNSRLDT
RVKGDTYTLTITEAIPDDSATYSFKSISPAGVNIKVFEVNVQEKQAQGEAPKFTQPLKSV
DVEEGMSATLECEVIGSPVPNITWFKDGERVEDAARYQTRSNGKRATFTVTNATLDDEGD
YKCVAENPLGSALCSCELLVNEANAKPEFREKMKPFNAVEGETTTFSVQVTGNPQPLIDW
YRGKEHLEEDERIEMLRNEERGVYSMTIKDTVPEDAGVYKCIARNDEGEASCKAALAVKE
LITEPTFEGQEGAKDEACTPVKVGEGDIISLSTMVKGKPCPSVDWFKDDQKLLETSRLKM
DAKDGEISLLILEAKPNDSGLYKCKARNKAGKAQKTFDVNVQAKKPMGSAPIFIEPLQPV
EVVEGSAAKLQCRLTGSPEPNIQWFKDSELVKEDKRTKMRFDGELCTLKILSTELDDEGV
YKCVAKNDFGSVASDSELLVNEANKKPEFVEKMKPMNVSEGEAARFDVQVEGYPAPVVEW
FKGKDKLEDEGRYVMMDDGKEGRFTLIVENAGPEDAGSYKCVASNEEGHASSKAALAVKE
EMLMPEFLDEEGSGPIDVTDGDELCLTIGVKGKPVPSVAWYKDDRKLRKTSRIQIDAKGD
QFSLVVLDIKPEDSGIYRCEASSKAGTITRTFNVNVAAKRPEGRAPEIVRNASDIEVEQG
EPARIECQITGNPIPYVEWFKDSEKVKETKRIKLEADQETFSLNFKETELDDEGDYKCVA
RNEFGSLSTQAELLVNEATTKPEFREKLKNVNVQVGKEARFDVFVTSFPPPEVDWMKEGE
KIEDDGCFTLVDGEQDGQFALIIKNVKPEHTGKYKCVAFNEVGEASCNGNLVVEELLIAP
EFAAEAESAPVIGGEGEAVELAVELKKGHPEPQIEWLKGDTPVEIDEHVAFAVEQDLHSL
TIAKATPEDSGLYRFRATSKAGSIERSFNVQIAAKKPEGIPPQFTETLKTLEVNEGRPAK
LQCRVEGHPLPSTEWFKDGAKVKESRRVKAERDGDAVCLSFKETLAADSAEYKCVASNDF
GSVSCSTELTVRALSKPDFKEKLKGVEVLEGDTASFEVLISGYPEPKVEWFKGTTKLENV
GRLEVICSRDENRFTLNIGNVNQDDTGMYKCVASNEVGKATCRADLNVKERLFAPEFSEE
QSDSSLNVTEGDEAALRVTISGKPKPDVRWYKDGKIIRESNRLDIKARGDKFSMTILRIK
SDDSGVYKCEAKSKMGTVARTFDVRVAAKRPTGTAPEFTSLLRDVSVVEGKPATLKCELT
GEPRPDIEWFRDGEQVKESKRVKMEFEGKVCSLIFKPIELDDEGEYKCVARNELGSASSK
AELLVDEADSAPEFIDTIRDITVQAGEEVRFDVRVFGVPPPEVDWYKGQEALEDEGRFII
VDDVQKDLFTLIIEEALPSDSGEYKCVAYNEFGNISCTGKLVVQGELISPQSSIAMENAV
PIDEDRAIIAPEIAEVGESAPVAISDITVDAEKPEGTAPVILEPVQPVEVKEHSEAKLQF
TVAAEPKPNVEWFKDGIRVKENRRVKINNDGSRVTLAIKETRSSDQGQYKCVVANDLGTV
SCVANLAITVITKPEFKEKLKATEVTEGDPVRFVTQVTGYPVPELEWYRGTTKLENEDRI
ELRESKDELTYSLVISNAQREDAGMYKCVASNEGGKTSCRADLIVKERLFAPEFAEEQSE
APINVTEGGEVTLHVTVAGKPKPNVKWYKDDKPLRESNRLDIKARGDKHSVVILGVKGDD
SGVYKCEGKSKMGAVTREFRVIVTAKKPAGSPPEFTQPLKTEEVVEGVTVKLTCSLKGVP
QPTIRWLKDGEPVKTSKLLKETFEGDVATLVFSKVELDDEGDYECVAENEFGSASCSAEL
LVNEADSKPEFSKTMKDIEVELDSEGRFDVQVSGVPMPTVEWFKGTEKIENEGKFSLIHE
EEGLFSLVVDQVSTDDVATYTCKATNDLGEVSCEAELRLEPMIGPEFVDDVESGPIIAEE
GADVELVAVVKGKPSPDVEWYKDEKPLTKTSRFDTRTRGDKFSLVILNVTPDDSGLYKCL
AKSKRGSATKTFEVNVEGKRARKPKGKAPEFTQALKAIDVEEGKPVKLKCRMTGTPEPTA
QWFKNGREVTLSRRIKADIIGDMCQLSITESQMDDTADYKCVVKNELGSAACECELTVTK
PLAAPEFKLKLKNVHVNEGEQAQFHAKAVGNPKPKIEWFHGTQEIVNEGRFTITSGETDE
ESCLLIDDLTIDDSGIYKCVASNSVGKTTCRGELEVSEQLRAPEFVDNLIDAPINVKEGE
ELSLPVIVNGNPLPDVQWYKDELVVRKSSNVSILSSRDKQSLQIYRAKPADSGVYKCVAK
NEMGTATRMFQVNIEAKKPQGTPPEFFKPLKMVEVVEGSAAKLECWIHAKPEPVIEWLKD
DEPIEPNKRLKTYFDSEVCRLTISDTVTDDEGEYKCSATNEFGSASCTAELLVNEAIFMP
EFKEKMKHAEVVEGDTARFNVRLVANPQPKVEWSKGGKTISSGGRLRVEQSDDLHSLFID
NTSMDDFGTYKCVASNEAGRIHCSARLDVKEKEISPEFSEYCDSPIELTEGDEIKISVTI
DGNPRPDVEWYKDDRPMRRTNRVSLSTRGTKYSATIHTAVPEDSGVYKCVAKSTAGKTTR
NFQVNIERKKPAPKFIQPLQETGETLGGTVYLSCRLNTTPKPNIEWTKNGRPVIESRRVR
AEFDGELCSLVISDVKREDGGEYQCTAKNTIGTATCRCALVVSDAVVKPEFREAMKDLEL
VEGGEAVFSVSVAAEPDPHVQWFLRKMRIKNGGKYTVDEDPERLTYSLTISDCRREDSGQ
YRCNVKNSAGEITSSAELKVNEKVFAPTFVQGTEGQLFEIWEGAPVKLMVQAKGKPAPQV
EWFKENRLARRVKRVELETDGDKSILLIAKAVPEDSGNYRVEATNAAGTAVKHFSVKVNA
QKLVLRREPVPPGAVKPEFIQRLQDVEIVEGSAAKFDVRVKGTPEPDVDWYKDNRVIREG
GRIKFKFEDDGLCSLLIREAEASDRGRYKCVASNPAGKAQCSAELFIESHGFDSASGSDY
DKRLSRESTFELLSDDTEDEVDSVTTGPPKLPPDITLVLRNRDVKEGGVTKFACRVISKT
PLTVEWFKDEQLVSKWPRFTCESDEDLFALNITDAKRTDAGHIRFIARNEFGHVESNAYL
NVEPDMEAEFEGATPRFTQKLKDVDAVPGKAARMECRVIGDPQPDIRWYRENEPLLEGGR
YVFEENGDLQVLIINDVTANDEGLYKCVARNCAGKAHCSADLLVAPTEDEESESTSEQEA
EEVKKPSPVHETVSPVAAVVEETAPPLEIEPKPKVKPEPHKPKERLREPEFILKLRDRSV
VEGSSIRLACRAMGTPVPSFQWFKNDQPINSDGRYDITESVSGFTLVVKDCQLEDSANYK
CTATNKAGSVSTAAKVTVTALSKPREISARPEFQQKLSDTTVTKGEEVRLFVKATGNPNP
EVEWQKDGKTLRDGRRTKIEKDKNGLHSVRIPYSESSDQGEYMCIVKNRAGKVTCSAKLI
VNAPKPEIKEGVMSLPKMPVEETVTVATDEPVSRAPEEDRGPVAPPKFVRTMKSADVIEG
SAARFDVQVTGHPEPEVKWLRDGKPLKENRKFRFDEDDDGKFSLFVTEVELDDEGLYKCV
AFNNNGEASCEAELLVEDIDGTESSETSEDDTSKETMKRETPTALKPKLEIKSVPKPVFQ
TELQDKQVKEGDNLTLDVKVPTECMAEVKWYKDDQELKEDYHIAVISAGEMHAVNIFSVS
VKDEAVYCCVATNGAGSVHTDCEVLVEEKVKVPQKSKNQGRLSQMAPEFVQECSDIRVVK
NSTAQLEVIATGSQPLQIRWFKDNEPIKYDRRLKMSSDGEHCTLKISAVQTQDQGIYKCV
ISNKAGTQSCEAMISVEESHSVAESVDGATTGPLVPKRASLQKSGSKPSIVTPLENIETN
HGDNILLKVTSGPEPIDQIEWFKDNELIRSQPRFVQSSRDFNHFLEIHAIDVDDEGIYKC
VLLNTWGIASCSAEVLVEESISESSSQDDEQLEKINARLERRRSRDSVNEPEFLQELRNL
EVTAEDLVYMTIKASGTPEPEITWYKNGELLKEDTRVKFIKDSDPGSCSLLINKAVLEDG
GRYRCVASNMGGSVACQARLSVKELESKRGGEAPRFTAPLKNRIIEDGSAARFDVRVRGQ
PAPQVTWYKDDEEITGHKFPHIKVFQEDNLFSILITEGKIKDAGQYKVVAKNVLGDASST
ASLIVEALGQLPLEGDQKTPRKSSGLSRVEEVLTLKLYTAIEDFYSEETGNKFLKKGDKV
EVLDTSRPEFWLVRRVSRGSEIGFVRHTCLKKDEDG
NT seq 24051 nt NT seq  +upstreamnt  +downstreamnt
atggatgcacgttggcaaaggtttctgtcaaggatggaagaccacagaactatgttggag
gcttcaattgagttccatcaactttatgaacaagcttctgtgtggataagtgatagtgag
cactttttgaaaactactcaagatggggcaaagagatgcaaaactgaggaagaagtcatt
gatcttcttgacatgatggagggctttgtgaaacctggcctacacaaacaagatgcacgt
ctgaataaactggctgaactctctgccaagctcaccatggaggagcctcgtcttaaagcc
aagggcctcatggtgaaacaaaaggaagttgctaaaaagtttgaactcatggacaatgat
cttttccgtttagcagagaggctcagagaaagaaaacgccagggactgcccccagaggca
gaggaagtaaacatagaaagtattgaggcttatgaaaatgaactggctcagtcagcacct
ttgtcagatgagtctgaaaaaccagtgcgtgtgaatgttctctcttcctttatcgatggt
gttcttggaagcaaaagggttggagatcaggaagtctatgaagaagctggtcctgctaaa
cgtccacaagtgtcggtcagagtgaggtctgatgctccagtcagctttgaagctgagcaa
aagattgcacctatcatcaagtctgaaatccaaggctggtttgaaagtggaaaggctgtt
aaacctgttgagatccctgagcatgaaatctttgttcatattagtgaagacaccaaaaga
gaagccagtgaagtggctttggctccttggggtgctgaagtggtaaagaaagatgtgaca
atcacttcactagggccctttgttagcaaggatattgaagttgaaacagctttgcagaca
gaaacaactcagccaagcccaccagatcaggctcaaattatgaggaaaaggatctggaag
acaacaacaagggaaactactacaagtatcaagcaagaaacaagaaccgaagtggaaatg
cttgttccagaaaaacctgagatgacctcaaatttgtatgtgtttggtgctttgccccct
tctgagaatctgacagtggaggtgcggtccaagaaaactgttgagagcacacctgacacg
atggaaatgacaagcaccgaagagattgacagagttgagagggagatgcaagcagcaaat
gaaagcatttgtcggaaaattgaagagtcccttgcaagcactcgaaggattttgcaaccc
aacagtcatgcagagatagtcatccctcaacatgcaggctctgttttgatcttcacacca
cctggcacacctcgcaggctatctattccctgtgttgattcaagccatgtagccaatggc
catgcaagtgaccatgatcagcctaaagtagaatctgagctgtgtttggagacaactcct
caaggatttgactttggggctatagagctgacaattgcatctccttgtgtcaatggggaa
gtgcttgatatgaagagagaagctgctctgcaacagatgaatgaaatcacagacaggtta
attgccagtgaagagaagtatctgagtgacttgagatctcttactgagaattatatttac
cagcttccaaatgctccaccagaggtttcagacaagaaagaaacaatttttgttaatgca
gaggacatcttttacttccacaaagtggtctttcttaaagagctcagcaagtgcagagga
acaccatcagacattgggagagtgtttacacaaagggaaaatgagcttgacagatacatt
aaatactgtgatggaaaatatgactctaataattttatggaatcacatcctacagaattt
ttcaaggagtgtgaggaagaagcatcctgtcgacctattgaggagctgcttgatagaccc
gttgagcgcatcttagagtacagggcctatttaggtgacctgttagagtgtggtcgaaag
gcaggtgtggatacacacgacctggaggctgcgaaggatgtggtagaccgcctgtgtgct
gaaatcactcaacgcactcagttcgagatccttattcaggaggcaccaaaggaagttgag
ctatgtgttacgttacaagactacagagatgacctcaacaatatttgcctgaagaaaggc
gagactgttttggtggttgatcgattttctcggcaagggatgtacaaggttgtgaagttt
cgccctgatggatctagaggcgatgaagtctggataccaccctacgtcttgcaacgcaag
aggtcaaaagctgagatcgtcattcctgcagaatactctgtcaagctgaagaaggcaaag
cctgcacctaaaataactaaccagttctcagaaatcaccattccagcacctgaaagagaa
gttgttgttgaaatgtcaccagtggacatggctccattgccgatagcgcctgtatttaca
ttgcccctcgaaaatcagaaaataacagaagggcaaccaactcagctggatgttcgtgtg
tctggcattccagagccagagattgcttggattaaggatggccgcccggtgagaactggg
gagcgcatgcatgctgagaagataggtgatttgtacagcttgaagatatcagaagttgat
attgaagatgaagggatctacacttgtcaggcaacgaatgaagcagggacagcttcatct
caggcagatcttagtgttgagtataaagattccaggaaagagcaacacacagtcactcta
tctcttgatcgaacagatggaactattttccctcagcttgaagtacaaattcctaaattt
gatgatgttagtgcttcccgccgacgctcaatacctcctgatttcggcactgaactggag
gacaagaccattgaggaaggagattccgtggaaatgcagatctttgttactggtacagct
ccagtggacgttatttggtataaggatgaccagccaatcactctgtatcctcacaggcga
ttctgtgccacgagggaaaacgagatctgtagcttagaaatcaaggatgctcgttgcagt
gatcaaggaaattacacctgtgtcgcaaaaaacaccgctggtgaagtcaggaagtcatgt
aaactatttgtaaagcaagttactccgacaagtcctccttcatttgtgaagcatttgaaa
gatgggttcattgtagaaggctcttgcactcgttttgatgtcaaaatcacaggaatgcca
gaaccagtagtctcttggtacaaggatggattgcccttggatgaagacaagcacttggaa
atcgtccatgatgaagatacgtctgcattgattttgatgtatggcaaactaggtgatgca
ggggaatatagttgtgaagcagtgaacgaagctggagcggcacggtcatctgcacgtctt
catgtttcgcctatacaggttcctgcaaaattcacctccacaattgaggatgttcaagtg
ttagagggggaaccgctacagctgaaatgtacatttgtgggaaagccagatccaaacata
atatggttcaaagatggcgaggagatccatacgaccagtaagtacaaaatgaagttgaac
ccagacaacacttctatcttggacatagagaaagctgatatggatgatgagggcacatac
acttgcacagcgatcaatcctgctggtagcgatacttgttcaggcaagttgtctgttaat
gctgtaggcaagcacccagaattcatcaaactactggagaatgctgaagtgccagatggg
tgtccagttcgttttgaagtgcatgttcagggagaaccatcaccatctgtagaatggttg
aagggaacaaagatcttaaaaactggtccacggtttgaaagcgagtcaaatgggaatgtt
cacacctttgtcataacaaactgtagagatgtcgacagcggcacttattcatgcaaagcg
caaaacaagtttgggacggctacttgtgatgcaacacttgtggttgccgaagacactgtt
cccccgagattcacaaagaaactgtacgactcaacggccgatgctggaaacactgtggaa
ttctctgtcaagtacataggcagcccagaaccaaacgtgaagtggtttctcgatgacgag
gaagtttctgaggatgatgaaggcatggacatcgagaccgtaccaggctcatctttactt
gttctcgaagacattgctcccaatgactctgggcaatacaagtgcataatcaccaatata
gctggaaaagcagtaaccagtgcacaactgaaagttgtagatgaaggtgtcaaaggaaag
cccaaagttccgtatgaaattgtggaggtcctgggtccatcagttgaaacagagaaagtt
ggaaaaccccctgagttttctaagaaatttagctctgtccatgtcgttgaaggagatgca
gttcggttcgaagtggtagtggagggaacacctaatccaacggtacattggttcgttgaa
aatgcctcagttaaagaaagggtacaggccccctattttttaaggaaaccaacaagctca
cgtgttgaagagggaggttctacttctattgaggtccaagttgatggtacacctgtgccg
actgtaacatggtacactgaagaaaatgaggaaatacctgaacgaggacacatccgttgt
ttgccagatggaacattggtcattgaaaacgcagaactggatgacgaaggcttctacagt
tgcgttgcaggaaatgaagctggaaaggtgtcttgcaaagtagaagtcttggttgatgag
tgtaccagtaaattacaagaaatcgtagaagaaataccgttctctcggaagcttgtagta
gagagtgaacttcctgtagcaggtttgcttgcattgtcaagagaagagaccccacctgag
ataacaaaaaaactgcaagacgtcagtgtgcgagagggggatacagcaaggtttgaagta
gtgcttgctggaacaatgaagccagacgttcaatgggtagccaacaatgcagagataatg
gccaacgaggaaacgatactggaagccaacgatggcactcacagtctcactttaatgaat
gtgattctagatgacgaaggagagtacacgtttactgctctgaatgatgcgggaaaggtt
tcatgcactgcaaagctcttggtacaaaagaacatcataaagccatctttcttggattca
cttagggacattgaggtggtagaaaatagtgatgttcggctggaggttcgtgtacaagga
acagagcctgatattgaatggcacaaaaatgggattgccatcgaagaggcaacttctcga
actgaattcgttgagaatgaagagaggggtacttatgcatatctcatttatggtgccaca
acgaaagaccagggcacctatcgatgcaaagcagttaacaccgcgggtgaagcattttgc
gaaggaaagttgaccgtgaaagaacaggtcattcctcccagattccttcaacgtctcgag
gacaagaaagttgtagagggtggtcctgtagacttagacgttgagataagtgggaagccc
aaaccaaccgtaaggtggcttaaagacggtgaacatgttgctcctgataatcgtattcaa
atggaggttgagggtcgcagccatactttgtcaatatctcgctgtagactatcagatgat
ggaaaatacagctgtgttgcttctaacagcggtggtagagaaacctgtttggccatttta
aaagtggaagaaaaactgcgtgccccccaatttatcgcacaacccgaggacgttcagata
gttgagggaagtcaagctcaatttaaggcagtcgtatctgggctaccagaaccagaaatc
gagtggtttaaagatggcaaccttattcgagacagccaccactttcagcttgaattcaat
gagaataaatccgttcttgtcatcaaagatgcaaagcaaactgacgatggagaattcact
tgcactgcaacaaataaagcggggaaagtttcatgcagcgtggtcctggtggttggagaa
acaactgttgctcctgaatttgcgaagacaatgaatggctttgaactatgtgaaggagat
ttagtcagatttgaggtccgtgttaccggtactcctcaaccgaacgtacagtggttcaga
aatgacaagcaattgggagaagataagcgcttggatttttttactgacgatgatatgtat
tccttggaattgcccaattgtttattatctgatagcgggatgtaccgttgcgttgcttcg
aatgaagctgggcaggcctcatgcagtgcagaacttattgtcagggagaagctcattcca
ccaatgttcacagatcaaccagattttcctgacaggattgaagaaggtggtagtatagtg
cttgaggcaactgtgagtgggaagcctgtcccagctgtgcaatgggttaaggatgatact
gctcttgaaggcagtcctcatattgatatcaaggatggagatggaaaacacactttgatc
atttctggtgctggtcctaaggactcgggaatctacaagtgtgttgcaaataatccagct
ggaacatctatcaggacgttcaatgtcagtattgaaggtaccaaagaggcaattccagaa
cctgaaatcacaaagaaattggaagaggttgaagttcttcgaggacaacccatcctgctg
gaatgtcacgtcgccaatgcagctgatgcacaagtaaaatggttccataatgacatcgtg
gtcacacaagatgaaagaatttctgtgtcgtttaacggaacggtttgcacgcttttcata
gagaagtcagtattagatgacgaaggaaaatatatgtgtgaaataaggaatgaccaaggt
atggtctcaagcactggagaagtaattgttgaagaaggaatgtccttgccaatctttcaa
cagaaaatgcagaatttgaacgtgatcgagggtgagaatgcttgctttgatgtccgtgtc
actggaaatcctgagccagttgtagagtgggtgaaagacggttttcagctggaagatgag
ggtcgcgttatgatcatagatgatgttgacgaaaatgagcctgaattgttttccttggtt
attgaaaactgccagcattctgatactggacagtaccagtgtttggctatgaatgaggct
ggaaaagctgagtgtttggcgcagctgctagtgttccctgtctcagactcaataagagct
ccagattctagtgacatcccattgatcttttcagaaggtcaggatgttactctgaaagcg
ctgatgatcaaggatagtgtcgctacgtgggtgaaggatgatgagcctattaagcaaagc
agtcactttgaagttggctctgcagaaggtgtacacaccttgacaattaaaggcgtaacg
tcggacgacacggggatttacaaatgtgagaccgatgctaacacaacaagcattttcaat
gtcaccattaaagccaaagatgaaatgtgtgttaaaccagaagttttaccagccaccact
gctgtagaggtgatggaaggaaaagaggccaaactttcctggaaagtgcttggtacacca
aagcccacggtaacatggctgaaagaaagcgaacctttggagattgataaccgtataact
agtgtcgtcagcgaggatgtgtactcactttgcttcagagaaactgtgttggacgatgaa
ggagagtatgaatgtaaagcacaaaacgactggggtacagcttcttgtgctttggaactt
ctcgtcaacgaactcgaagaggagcctcaaattaaaccagaatttgttgagaggatgaaa
gatttaaatgtttcggaaggtgactcgccgagctttagcgtcacagtcaagggcaacccg
aaaccagaagtgcagtggtttactgtagataaagaaatcacaacgacagagcgattcctg
gttgattcgttgattgatgatcgccactctttaaccatcaccgattgtgaaatcagagac
aaaggcaggtacaaatgtgttgcatctaacgcagctggcaaagctgtttgctcagggata
ctaacaattgaggagaagatgatctcaccgtatttcgctgaacaagccagtgaggtgcca
atgcaaattcaggagggtggtgacattacacttaaagtagaggtaaaggggaaaccaaga
ccatccgttaagtggttcaaggatgacaaacccgtaagtcgaacaagcactaaatacagg
actgaggcccaaggagacaaccatcaactgactattgtaggtggaacacctgatgataaa
ggaacttatcaatgcaaggccaccagctctgctggaaccgccactcgagattttcacgtg
aacattgaagatgaaactgaagacaaggaaaaagggacactcgttgaagaacttgtggtg
gtaaaatcaagcattccagtgagtgtgaagccgtttggagaaatacagcttcagttgccc
gtaaaagaagaggatttgccttccgagaagaagcttgagtatcctggacaaggcaatgcg
cccttgattccttacaccacagagtatggaccagttgagatggtattgccagtcactgcc
gagcggattttaccagattttattgaagtgtcgcaagacatgaaagtaactgaaggtgac
aaagtcgtcctaaaagtcagagtcattggacaaccatcaccggaggtcacatggttcata
gatgacgaaactattgaagcggaggaggggatatctctgcagtcagatggggacaaacat
cagcttgttatagatagcgcacatttggaagatgaaggggtttacaagtgcgttgctaag
aacgaagcgggaaaagctgtgtgtgaagtagagctactcgtgaatgaaatcaaaggaaca
gctgatgaatcgccccgtggcctacaaataacaaaggagatagaggatttagaagttgat
gaaggagatcctgctacattggaggtgtgttttgtcagcgatgctccaaccactgtgacg
tgggttaaggacatgcagcccctggaggaaggcagaagaataaagatcatcactgatgac
aacagcagtaggatgatcatcaagaaaacaattggcaaagatgaggggctgtatcagtgt
acacttcagagcggtgaacgggtgttaagcaattcagctgagctcatagtcgaagaacca
acagaggatgaaagagtaaacgtaagaaagccagttcttgttcagaaattagttgaccag
accgtgaaagaaggagaaatgctggagctacagatcaaatacattggttccaaaccagta
accgtgacttggtaccgagatgatgaagtgttgcaccaagatgatcgctgcaaattgctg
tccgacgatgacattcatttgcttagagttaatcccgtggaagtagacgacgaggctatt
tataaatgtcttgtaaaaaatcaaggtggacaagacctttgtgaagctaagatcttagtg
gaagataaactggaagaggaagagatttctgagatcactgataagaagccctacttcgtc
aaatcactgccagaagaagtggaagttttggaaggtgactcgtctcgtttagagtgtcgt
gtagcacatgcaacggaagtcttgtggttcttggaaaatgaattgttggaagaaaacgat
agagtcacctttgaaaacgacggcgatgtctatgcggtcctcatctctcccactgaagtc
gacgacgaagcagaatacaaatgcgttgcccagaatgagtttggcaaggtgtcctgtaaa
accgaactgatcgttgaagaaggtgtcacgatgcctctgattaaggaaccgttaaagaac
ttggacgtgaatgttggtgatgtagttcgctttgatgtaagaatcgcaggaaatcctgaa
ccagtggttgagtggtttagagatggaaagctgttggaagatgagggtcgctttgtgatc
atcgacgatgtggatgacagtgacaaagaattgttctcattagttattgaaggttgtgaa
ttggaggattgtggagtttacaaagtcgtggcaatgagtgaagctggaactacagattgc
cagtgcgatttagttgttacccgtgcaactgttccaccagagttcaaggacgaaatggaa
gaggttcccttggaaggctcccaaggcgataacatcaccatgtccgttcatacgggtcgt
cttcctgcaccagctattgcctggtttaaagacgagcagcccattgtgtccaattcccat
cttgagatcatagatgaaccagaaacctgcaagctggtggttacaaatatcacgcccgca
gattcgggaacatacaagtgtgttgctaccagtatcattgggactgtaactaagaaattt
cttcttaacatcgaaggatcagaagaacccgtgaccgtttctgatgctgctgaactcgct
ttgtcaatcccagaacgaccagtggtggatttatctgctcctgtgtttacaaagaagatg
gacgatgttaccgttgaacctggtgaggaagcacgctttgatgccagaatccgtggggtg
cctgaacccaacgttgagtggtacagtggatcaaaaaagataatggatgaaggacggttt
gttcacatcgatgctgtccaggaagacttattcactctgataattgaaaatgtcatgcca
agcgactctgggcctttcaggtgtgtcgctacgaatgaggctggtgaaatgtcctgtgaa
gctcatttgacagtcggtgtaacaacaaaatccgctggcatcgagccagaaaagtcagtt
ctcaatgttggagaaggagatgaagtaaacttaaatgtaacattctcaggaacaactaaa
cccacagttgagtggctcaaagagggcaagccagtgcgcaagaacagtagacttgataca
agggtcaaaggagatacatacactcttactatcacagaagctatccccgacgattccgct
acgtattcgttcaagtcaatcagccccgctggagtgaacataaaggtgtttgaagtaaat
gtgcaagagaagcaagctcagggtgaagcccccaagtttactcagccactgaaatctgta
gatgtcgaggagggaatgagtgcaacgctcgagtgtgaagtcatagggtcacctgtaccc
aatatcacttggtttaaagatggtgaaagagtggaagatgcggcacgataccaaacgcga
tcaaacgggaaacgagcaacatttacagttacaaacgcaacactggacgatgaaggcgat
tacaagtgtgttgctgaaaatccattagggtcagccttgtgttcatgtgaacttcttgtc
aatgaagccaacgctaaacctgagtttagagaaaagatgaagccttttaatgcagtggaa
ggggaaacaacaacattttccgtgcaggtcactggtaatcctcaaccactcattgactgg
tatcgaggcaaggagcatctcgaagaggacgaaagaattgaaatgttacgcaacgaagaa
agaggcgtctactctatgaccatcaaggatacagttccagaggatgccggtgtgtacaag
tgtattgctagaaacgatgaaggggaggcttcatgcaaagctgccttggcagtgaaagag
ctcatcactgaacccacatttgaaggacaggaaggtgcaaaagatgaagcgtgtactcca
gtcaaagtcggggaaggtgatattataagtcttagtacaatggtcaaaggaaaaccttgt
ccttccgtcgactggttcaaggacgatcagaaacttctcgaaacgagtcgtttaaagatg
gacgctaaggatggagagatctctctgcttatcctggaagctaagcctaatgactctggg
ttgtacaaatgtaaagcaaggaacaaggctggtaaagcacagaaaacctttgatgtcaac
gtccaagcaaaaaagccaatgggatccgcaccaatcttcatagaacccttgcagccagta
gaagttgtggaaggatctgcagcgaaacttcagtgccgactgactggatcacccgaacca
aacattcagtggtttaaagacagtgagcttgtgaaggaagacaaaagaacaaagatgcgc
tttgatggggagttgtgtactttgaagattctctcgacagaactggacgatgagggtgtt
tacaagtgtgttgccaagaatgacttcgggtctgtcgccagtgactccgagctccttgtt
aatgaggcgaacaagaagccagagtttgttgagaaaatgaagcccatgaatgtctctgaa
ggagaagcagctcgttttgatgtccaagttgaaggctatccagccccagttgtggaatgg
tttaaaggaaaagacaaattagaagatgaaggccgctatgtcatgatggacgatggaaaa
gaaggaaggtttaccttgattgtggagaacgcaggtcctgaagatgctggttcatacaag
tgtgttgccagcaatgaagagggtcatgcaagctccaaggccgccttggctgttaaagag
gaaatgctcatgccagagtttctcgatgaagaaggaagtgggcccatagatgttacagac
ggagatgagctctgcctaacgattggtgtcaaagggaaaccagttccatctgtggcttgg
tacaaggatgacaggaagctgaggaaaaccagtcgaatccagattgatgcaaaaggtgat
caattttcattggttgttttggatattaaaccggaagactcgggcatctacaggtgcgaa
gcctccagcaaagcggggactataactcgtactttcaatgtgaatgtagcagctaagaga
ccagaaggaagagcaccagaaattgtcaggaacgcgagtgatattgaagttgaacaaggc
gaaccagcgaggatagaatgccaaattacaggaaatcctattccgtatgttgaatggttt
aaagacagcgagaaagtgaaggaaactaagcgcatcaaacttgaagctgatcaagaaacc
ttctcgttgaatttcaaagagactgaacttgatgatgaaggtgattacaagtgcgttgca
aggaatgaatttggtagtctatcaactcaagctgaactgcttgtcaacgaggctacaacc
aagccagagttcagagaaaaactgaagaatgtcaacgttcaggttggaaaagaggcgaga
ttcgatgtgtttgtaactagttttcctcctccagaggtggactggatgaaagaaggcgaa
aagatcgaagatgatggttgtttcaccttggttgatggtgaacaggatggccagttcgcg
ttgattatcaagaatgtgaaaccagagcatactggaaagtacaagtgcgtcgcattcaat
gaagtgggtgaggcatcctgcaacggtaacttggtcgtagaagaactgcttattgctcct
gagtttgctgctgaggctgaaagtgcccctgtgataggtggtgaaggagaagccgttgaa
ctggccgttgagttgaaaaaaggacatccagagccgcaaatagaatggttaaagggtgac
acaccagttgagatcgatgaacatgtggcctttgccgttgaacaagacttgcattcgctt
acgattgccaaagcaacaccggaagattcgggtttgtacaggttcagggctactagcaaa
gctggctctattgagaggtccttcaatgtgcagatcgcagcaaagaaacctgaaggtata
cccccacagttcactgaaaccctgaaaaccctggaagtcaatgaaggacgtccagcgaaa
cttcaatgtagagtggaaggccatccgctaccctcaactgagtggttcaaagacggagcg
aaagtaaaggagagcaggcgagtcaaagcagaaagagatggcgatgcagtttgtctgtcc
ttcaaggagaccttggcagctgacagcgccgagtacaaatgtgttgcatctaatgatttc
ggctctgtttcgtgttccacggaattaacagtaagagccttatctaaacccgacttcaaa
gagaagctaaaaggtgtggaagttctggaaggtgatactgcttctttcgaagtgcttatt
tctggttatcctgaaccaaaggtggagtggtttaaaggaacaacaaaactagagaatgtt
gggcgtttggaggtcatatgtagcagggacgaaaatcgctttactctaaacatcggtaat
gtaaatcaggatgacactggaatgtataaatgtgttgcatcaaacgaagttgggaaagct
acatgtcgagctgacctcaacgtgaaggagaggctatttgcccctgaattctctgaggaa
cagtcagattcttcattaaatgtgacagaaggtgatgaggcggccttacgtgtaacaatc
agcggaaaacccaaaccggatgttaggtggtacaaggatggcaaaatcatccgcgaaagc
aataggctagatataaaggcgcgaggggacaagttttctatgaccattcttcgcatcaag
tcagatgactctggagtttacaagtgcgaggcaaagagcaagatgggtactgtggcaagg
acattcgacgtcagagtagcagccaaaagacctactggaacagctcccgaattcacaagt
ctcctgagagatgtctccgttgttgaggggaaaccagcgactcttaaatgtgagctcact
ggagaaccacggcctgatattgaatggtttagagatggggagcaagtcaaggaatctaaa
agagtaaagatggagtttgaaggcaaagtgtgctcgttgatttttaaaccaattgaactt
gacgatgaaggtgagtacaagtgtgttgctcgtaatgaactcggcagtgcatcaagcaag
gcggaactgctggtggatgaagctgatagtgcaccggaatttatagacacaattagagac
atcactgttcaagctggagaggaagtaaggtttgatgtacgagtgtttggtgtgcctcca
cccgaagtagattggtacaaaggacaggaagcccttgaagacgagggtcggtttataata
gtggatgacgtgcagaaagacctgtttacactgattattgaagaggccctcccaagcgac
agtggagaatacaagtgtgttgcatacaatgagtttggaaacatttcgtgcacagggaag
ctggtagttcaaggagagctgatttcaccgcagtcttccattgctatggagaatgctgta
cccattgatgaggatcgagcaattatcgcacctgagattgcagaagtgggcgaaagtgca
ccagtggcgatcagcgatatcacagttgatgccgagaaaccagaagggacagcaccagtt
atcttggagcctgtccaacctgttgaggtaaaagaacacagcgaagctaaactgcaattt
accgtggcagcagaacccaagccgaatgtggaatggttcaaggatggaattcgtgttaaa
gaaaaccggcgagtgaaaataaataacgatggtagcagagtaaccctagcaatcaaagag
accagatcgtctgaccaggggcaatacaagtgtgttgtggcaaatgatttgggtacagtt
tcctgtgtagcaaatttagcaatcacagttattaccaagccagaatttaaagagaaactc
aaggcaactgaggtgaccgaaggagaccctgtcagatttgttactcaagttactgggtac
cctgtgcccgaactggagtggtacagaggaacaacgaagctcgaaaacgaagacagaatt
gaattgagagagagcaaagatgaacttacttactcgcttgtaattagtaatgctcaacgg
gaagatgctggaatgtacaaatgcgtggcctcaaacgaaggtggtaaaaccagttgccga
gccgacttaatcgtgaaagagagattgtttgctccagagtttgctgaagagcaatcagaa
gctcccattaatgtcacggaaggtggagaagtcactttacatgtcacagtagcgggaaaa
cccaaacctaatgtaaaatggtacaaagatgacaaacctctgcgggagagtaacaggctt
gacatcaaagcacgaggagacaagcattctgtggtcattcttggtgtcaagggagatgat
tcgggagtgtacaagtgcgaaggaaaaagcaagatgggcgctgtaaccagagaattccgt
gtcattgtaacagcaaaaaagccagctgggtctcctccagagtttacacagcctctcaag
acagaagaagttgtagaaggtgtaacggttaagcttacttgcagcttgaaaggagtacct
caaccgactattcggtggcttaaggatggcgaacctgtgaaaacgagtaagctactgaaa
gaaacgtttgaaggagatgttgctactttggtattttccaaggtagaactggacgatgaa
ggcgattatgaatgtgttgcagaaaatgagttcggatcagcatcttgttcagctgaactt
cttgtcaacgaagctgacagtaaaccagagttctctaaaacaatgaaggacatcgaggtt
gagcttgatagtgaggggcgttttgatgtgcaggtttctggtgttcctatgccaacagtg
gaatggttcaaggggacagagaagattgaaaatgagggaaagttctccttaattcacgag
gaagagggtctcttttctcttgttgtcgatcaggtttctacggacgatgtggcaacatac
acttgtaaagccacaaatgatcttggggaagtcagctgtgaagctgagctgagattggaa
ccaatgataggccctgaatttgttgacgacgttgagagcggcccgatcattgccgaagaa
ggagccgatgttgaacttgttgctgtagtcaaagggaagccatctccagatgttgagtgg
tacaaggatgaaaaacccttgacaaagaccagtcgttttgataccagaacacgcggagat
aagttttctttggtcatcttaaatgtcacaccagacgattctggattgtacaaatgtttg
gctaaaagcaaacgcggaagtgcaacaaaaacctttgaagtcaacgttgagggtaagaga
gcaaggaagcccaaaggtaaagctcccgaattcactcaagcgctgaaagcaattgacgtt
gaagaaggaaaaccagtgaaactgaagtgcagaatgacgggaactccagaacccactgct
cagtggttcaaaaacggcagagaagtcacccttagtagaaggattaaagctgatatcatc
ggagacatgtgccaactgtcaatcacagaatcacagatggacgacactgcagattacaag
tgtgtggttaagaatgaacttggttcggctgcttgcgaatgcgaactcacggtcacgaaa
cctttagcagcacctgaatttaagttgaaactgaaaaatgtccatgtgaatgagggtgaa
caggcgcagttccatgcaaaggctgttggtaatcctaagcctaagattgaatggtttcac
ggaacacaagaaatcgtgaacgaaggacgtttcacaataacatcaggtgaaacggatgaa
gagtcctgtttgcttattgacgatttaacgatagacgattcaggaatttacaaatgcgtg
gcgtcgaattctgttggaaaaacaacttgtcgaggagaacttgaagtcagtgaacaactc
agagctccagaatttgtggacaacctcattgacgccccgataaatgtgaaagaaggcgag
gaactgtctttgcctgtgatagtcaatggaaaccctcttcctgatgttcagtggtataaa
gatgaacttgttgtgagaaaatcatcaaatgtttcgatactctcaagtagagataaacaa
agcttacaaatttaccgcgcaaaacctgcggattccggtgtatacaagtgtgtggccaag
aatgaaatgggaactgcaacaagaatgttccaagttaatattgaagccaaaaagcctcaa
ggaacgccacccgaattttttaagccgttgaagatggttgaagttgtggagggaagtgcc
gcgaaacttgaatgctggatccacgcgaagccagaacctgttatagaatggctaaaggat
gatgagcccatagaacccaacaaacgactaaaaacttacttcgactcggaagtctgcagg
ctgacaatttcagatactgtgactgatgatgaaggagagtataaatgttcggcaacgaat
gaatttggcagtgcttcgtgtacggctgagctgttagtcaacgaagccatttttatgcca
gagtttaaggaaaagatgaaacacgcagaagttgttgagggcgacacagcaagatttaat
gtgcgtttagtagcgaatccacaaccaaaggtagaatggtcaaaaggtggaaaaactatc
agcagtggaggtcgacttagagtcgaacaatctgacgatttgcattctttgtttattgac
aatacgtcaatggacgactttgggacttataaatgtgttgcatctaacgaggctggaaga
atacactgctctgcaaggctcgatgtcaaagagaaagagatttcaccggagttctctgag
tattgcgactcaccaattgagttgaccgaaggtgatgaaataaagatttctgttacgatt
gacggcaatccccgaccagatgttgaatggtataaagatgatagaccaatgcgaagaaca
aatcgagtgagtttgtctactcgaggaacaaaatacagtgcaacgatccatactgctgta
cctgaagactcgggagtgtacaagtgcgtggctaagagtacagctggtaaaactacaaga
aacttccaggtcaacattgaaagaaagaaacctgctccaaagtttatccagcccttgcaa
gaaacaggtgaaacgcttggcgggacagtctatcttagctgccgattaaacacaacgcct
aaacccaacatcgagtggactaagaatggcagacctgtgatagaaagtcgaagggtgcga
gccgagttcgatggtgaactttgttctcttgtaatatcagatgtcaaacgtgaagacggc
ggcgagtatcagtgtactgctaaaaacaccattggcacagccacatgtagatgtgctctt
gtcgttagcgatgcagtggtcaagcctgaattcagggaagccatgaaagatttggagctc
gttgaaggtggtgaggcggtgttttcagtaagtgtcgctgctgaacctgatccacacgtc
cagtggttcctaagaaagatgagaataaagaacggagggaaatacaccgtagacgaagac
cctgaaaggctaacgtactcgctcactatttccgattgtcggcgcgaagatagcggacaa
tacaggtgcaatgtgaagaacagcgccggtgagatcacttcatcagcagagttaaaggtc
aacgaaaaagtttttgccccaacatttgttcaaggaacagaaggtcagcttttcgagatt
tgggaaggtgcgcctgttaaacttatggtccaagccaagggcaaaccagcaccacaagtg
gaatggtttaaggaaaatcgactcgcgaggcgggtaaagcgtgtggagctagaaacagat
ggagataagagtattctgttgattgccaaggcagtccctgaggattctgggaattaccgc
gttgaggccacaaatgcagcaggaacagctgtgaagcatttttctgtaaaagtcaatgct
caaaagctggtgctaaggcgcgaaccagtgccccctggagctgtaaaaccagagtttatc
caaagattacaagatgtcgagatcgtggaaggaagcgctgctaaatttgatgttcgcgtc
aaaggaacgcccgagcctgatgtagactggtacaaagacaacagggtgatccgtgaagga
ggacgaatcaagttcaagtttgaagatgatggtctctgttctcttctcattagagaagcg
gaggcgtcagatcgaggtcgctacaaatgtgttgctagtaatcctgctggaaaggctcag
tgcagtgctgaactctttatagaatctcatggtttcgattctgcaagcggatcagactat
gacaagcggctttctcgggagtcgacctttgaattgttgtcagatgacactgaggatgaa
gtggactctgtaactactggccctcccaagcttcctccagatatcacactggtgttacgc
aatcgtgacgtgaaggaaggtggcgtgacgaagttcgcatgtcgagtgatcagcaaaact
ccattgacggttgaatggttcaaggatgaacagcttgttagtaaatggcctcgcttcacc
tgcgagagtgacgaggatctatttgcgcttaacatcacagacgccaagagaacagatgcc
gggcatattcgctttatcgctcggaatgagttcggtcacgtcgaaagtaatgcttacctt
aatgtcgaacctgatatggaagctgaatttgagggagcaacaccaaggttcacccagaaa
ctgaaggacgtcgatgctgtgccgggtaaagcagctcgtatggaatgccgggtgatcggg
gatcctcagccagatatccggtggtacagggaaaacgaaccgcttctggagggaggaaga
tacgtgtttgaagaaaatggcgacctacaagttctcatcataaatgacgtaaccgctaac
gacgaaggcttgtacaaatgtgttgcacggaactgcgccggcaaggcgcattgctcagcg
gacttgcttgttgccccaacagaagacgaagaaagcgaatcaactagtgagcaagaagcg
gaagaagtgaagaaaccatctcctgttcacgagactgtgtctccagtagctgctgtagta
gaagagacagcaccacctctagaaattgaacccaagccaaaagtcaaaccagagccgcac
aaaccaaaggagcgtctccgagagccagagttcatactgaaattgcgagatcggtcagtg
gttgaaggaagctcaattcgtttagcttgcagagcaatgggtacacctgtgccctcgttt
cagtggttcaagaacgatcaaccaatcaattccgatggccgctatgacatcacagagtca
gtgagcgggtttacgctggttgtaaaggattgtcagctagaagactctgccaattataaa
tgcacagctacaaacaaagcaggcagtgtgagcactgcagctaaagtcactgtgacagcc
ctttcaaaacctcgtgaaatctcagcccgaccagagttccaacagaagctttccgacaca
acagtgacgaaaggggaggaggtgaggctttttgtaaaagcgacaggaaatcccaacccg
gaggtagagtggcagaaagatggtaaaactctcagggatggaagacgtacaaagatcgag
aaagacaaaaatggcttgcactcggtcagaataccttactcagaatcaagcgatcaagga
gagtatatgtgcattgttaagaacagagcaggaaaggtcacgtgttccgctaaactgatt
gtcaacgctccaaagccagaaatcaaagaaggtgttatgtctttacccaaaatgcccgtc
gaagaaacagttactgtggcgacagacgagccagtgtcgcgcgccccagaagaagacaga
ggccccgtcgctcctccaaagtttgttcgaacaatgaagagtgcagacgtcatcgagggg
agcgctgcacgatttgacgtgcaagtcacaggacacccagaacctgaagtgaagtggctt
agagatggtaaacctctgaaggaaaaccggaaattccggttcgacgaagacgacgatggg
aagttttccctttttgtgactgaggtagagcttgatgatgaaggtctttacaaatgtgtc
gccttcaataacaatggcgaagcttcctgtgaagcagaactcttagtggaagacattgat
gggacagagagctcagaaacgtctgaggatgatacttctaaagagacaatgaagagagaa
acacctactgcccttaaacctaagcttgagataaaatcagttccaaaaccagttttccaa
actgaactgcaagataaacaggttaaagaaggtgacaacttaactcttgacgtcaaagtt
ccgaccgaatgtatggctgaagtcaaatggtacaaagatgaccaagaactaaaggaagat
tatcacatcgctgtcatttcagccggtgaaatgcacgctgtcaatattttcagtgtgtcg
gtcaaagatgaggcagtttattgctgtgttgcaacaaatggtgcgggttcagttcacact
gattgtgaagttcttgttgaagaaaaagtcaaagttcctcaaaaaagcaagaaccaaggt
cgtctgtcccaaatggcaccagagtttgttcaagaatgcagtgacattagagtcgtgaag
aattctaccgcccagcttgaagtgatcgcaaccggaagccaaccgctgcagattcgctgg
tttaaagacaatgaacccataaagtacgacagacgactcaaaatgtcaagcgatggagaa
cattgcactctgaaaatttcagcagttcaaactcaagatcaaggaatctacaagtgtgtt
atatctaacaaagctgggacacagtcctgcgaggcgatgatttctgtggaagaatcacac
agtgtcgcagaaagcgttgatggtgcaaccaccggacctctagttcctaagcgcgcttct
cttcaaaagagtggctccaaaccaagtattgtgactccattggagaatatagagacgaat
catggtgacaacatcttgctaaaggtgacttcaggacctgaacctatcgaccaaattgag
tggttcaaggacaatgaactgatccgttcgcagcccagattcgtgcagtcatcgcgtgac
ttcaatcattttcttgaaattcatgccatcgatgttgatgatgaaggaatttataaatgt
gttctgctcaatacctggggaattgcttcctgctcagctgaggttttagttgaagagtcg
atatccgagtcttcctctcaagatgacgaacaactggagaagatcaatgctcgattggaa
cgtcggcgatcacgtgacagcgtcaacgagcccgagttcctgcaagagttgcgtaacttg
gaagttactgcagaggacttggtgtatatgaccatcaaagcatctggtacaccggaaccg
gagatcacgtggtataagaacggtgaactgctgaaagaggacacaagggttaagttcatc
aaagattccgaccctggcagctgctctcttcttatcaacaaagcggtgttagaggatggt
ggaaggtatcgttgtgtggcgtccaacatgggaggttcagtggcttgtcaagcaagactg
tcagtaaaagaacttgaatctaaacgtggaggagaagctcccagatttacagcgccctta
aagaatcgtatcatcgaggatggaagcgcggcaaggtttgatgtgcgtgtgcgggggcaa
ccagctccacaggtcacgtggtacaaagacgacgaagaaatcactggtcacaaatttccg
cacattaaagttttccaagaagacaacctattttccattttgataaccgagggaaagata
aaggatgctggacaatacaaagttgttgcaaagaatgttctcggggatgcatcatctact
gctagtttgatcgtagaagcactaggtcagttgcctcttgaaggtgatcaaaaaacgcct
cgcaagagttccggtctttctcgagttgaggaggtcctcacgctcaagttgtacaccgcc
attgaagacttttattctgaggaaactggaaacaaatttctcaagaagggcgacaaggtc
gaagtcctggatactagccgacctgagttctggttggttcgacgtgtgtcacgtggttca
gagataggatttgtgcgtcacacgtgtttaaagaaagatgaggatgggtaa

DBGET integrated database retrieval system