KEGG   Acropora digitifera (stony coral): 107341312Help
Entry
107341312         CDS       T04352                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like
  KO
K03252  translation initiation factor 3 subunit C
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf03013  RNA transport
Brite
KEGG Orthology (KO) [BR:adf00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    107341312
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:adf03012]
    107341312
Translation factors [BR:adf03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    107341312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 107341312
NCBI-ProteinID: XP_015762204
Position
Un
AA seq 705 aa AA seqDB search
MATESRFFAAGSSESESSSSDEEQPVVAKPAITTKPFAFSDDEEETKRVVRSQKDKRYEE
MTNILKQLKNHKKIKDFTQVLTGLNWEDSEGRKKLNKGNARSLATLRQRLRKYNKDFEED
IAKYRENPILSGESAQEDSERQQGPEDKERKKKKKEKKIKLKSKEGEDDEQGWTEVKGSL
TAMEKAKQLFPKDTEITHQVVLKKLREILSARGKKGTDRTDQIEFLKQLRIISDKASLGV
GMTVKLVFNVISSIFDYNTNVSTCMREEMWRECLVQIEELIDILIDSEGKVIVGENIPEE
SENVENADQPYKVRGCPLVTVERMDDEFTKMLQGCDCHSTEYVTRLRDEEKVCELIRKLQ
SYLEKTGSRSEICRIYLRHIDHRYYKVESGPDKDEDAKQESDEGEKGPKKEVESSSEGLD
KMCKFIYSRDTSDRIRTRAMLCHVYHHALHDRWFEARDLMLMSHLQETIQHSDIPTQILY
NRTMVQLGLCAFRHGMIKDAHNSLHDVQSSGRAKELLAQGLMQQRQYERTAEQEKIEKRR
QIPFHMHINLELLECVYLTSAMLMEIPWMAAHAYDYRPRVLSKSFHYQLRQSEKQTLIGP
PESMREHVVAASKAMKKGDWKQCRDYILAVKVWKLFRQTEKVQEMLTRKIQEESLRTYLF
TYNSVYDSLSLFTLAEMFELPPSVVHSTISKMIINEDLQVNLQLY
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaatctagatttttcgctgctggaagctcagagagtgaatcctcttctagt
gatgaagaacaaccagtggttgctaaacccgccatcacaacgaagccttttgcgttcagt
gatgatgaagaggaaacaaaaagggttgtgaggagccaaaaagataaaaggtatgaggag
atgacaaacatactcaaacaattgaagaatcacaagaagatcaaggattttactcaagtt
ctcacaggtttaaactgggaagactctgaagggcggaaaaaactaaacaaggggaatgct
aggtctttagctacactaaggcaaaggttgagaaaatacaacaaagatttcgaagaggac
atagcaaaataccgtgagaacccgatcctgtcaggtgaatctgctcaggaagattcagaa
aggcaacaaggtccagaagacaaagagagaaaaaagaagaaaaaggaaaaaaagattaaa
ctgaaaagcaaagaaggcgaagatgatgagcaagggtggactgaagtaaagggcagtttg
actgctatggagaaagcaaagcagcttttccccaaagatacagaaatcactcatcaagtt
gttttgaaaaagcttcgtgagattctctctgccagaggaaaaaagggaacagatcgcact
gaccagattgagttcttgaagcaattgaggatcatttcagataaagcatcattgggtgtt
ggaatgacggtaaagcttgtgtttaatgttatctcttccatctttgactataataccaat
gtgtccacatgtatgagggaagagatgtggagagaatgtcttgtccagattgaggaattg
atcgatattctgattgacagtgaaggaaaagttattgttggggaaaacataccggaggaa
tctgaaaatgttgagaatgctgatcaaccgtataaagttcgtggatgtcctttggtcacg
gtggagcgtatggatgacgaattcaccaaaatgctccaaggctgcgattgtcactccact
gaatatgtcacaaggctaagggatgaagaaaaggtttgcgagctaatcagaaagttgcaa
agctacctggagaaaactggctcaagatcagaaatttgcagaatttatttgcggcacatt
gatcatcgctattacaaggtggaatctggaccggataaggatgaagatgccaagcaagag
tctgatgaaggggagaaaggtcctaaaaaagaagttgaaagcagctctgaaggtcttgac
aaaatgtgcaaattcatttactcccgtgacacttctgatcgaatccgcacaagagcaatg
ctttgccacgtctatcaccatgcactgcacgatcgctggtttgaggcacgtgatttgatg
cttatgtctcaccttcaagagactattcaacattctgacattccaactcagatactgtac
aacaggacaatggttcagctgggactgtgtgccttcagacatggcatgatcaaagatgca
cacaattccttacatgacgtgcaatccagtggaagagctaaggaacttctggcccaaggg
ttaatgcagcaaagacaatatgaaagaactgcagaacaagagaaaattgagaaaaggaga
cagattccatttcacatgcacataaaccttgagctactggagtgtgtttatttgacatct
gcaatgttgatggagattccatggatggcggctcatgcatatgattacagacctcgtgta
ttgagcaagagcttccactatcagctgagacaaagtgaaaagcaaactttgattggtcca
cctgagagcatgcgtgaacatgtggttgctgcatctaaagccatgaagaaaggagactgg
aaacaatgcagagattacattttagctgtgaaggtttggaaattattccgccaaacagag
aaggtacaagaaatgctgactaggaaaatacaagaagaaagcttgagaacttatctgttt
acgtataacagtgtgtatgattcattaagtttgttcacattggctgaaatgtttgaattg
cctccctctgtggttcacagtaccatcagcaaaatgattattaatgaggatctacaggta
aatttgcaactgtattga

DBGET integrated database retrieval system