KEGG   Acropora digitifera (stony coral): 107341978Help
Entry
107341978         CDS       T04352                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00010  Glycolysis / Gluconeogenesis
adf00562  Inositol phosphate metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107341978
   00562 Inositol phosphate metabolism
    107341978
Enzymes [BR:adf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107341978
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107341978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 T2SSF
Motif
Other DBs
NCBI-GeneID: 107341978
NCBI-ProteinID: XP_015762930
Position
Un
AA seq 469 aa AA seqDB search
MAAFIVSFLLLFMFFLQHDLTASSISRPFLFSDKTQYHHRNEPIEKPPNCEAVHISMVIR
HGSRYPGSVRVKKMKDLLKEINQHLSRDSPIRYKNLSLPWSIPTDILDSAGKEMSSLGTE
EMYSIGKRLLSKFPNALQHGYSNLNYSFIATDKLRSSESAVAFAQGLFEGKGHLGPGKYQ
PVAIKSSGPSNEDTYLRIFEACPKWKKRTAKGNREYANFTKGPEMRRVLENISDRLKLGK
SFSARLEYQWAVEMFLMCAFGIQTDSADTSWCDLFEEEDLKVLEYLNDLKLYWDRSYGRK
INHRMSCRLYENITVSFDRFLESGKPHGVFRFAHTGTVIPLLTMLGMYKDVVPLRADNYL
LQATRKFRISNVVPMGGNVAFVLYNCKNESSMNLGDEADEKRTFSVSQMTIQLLVNEAAV
PMPACGGRMYCGLQKFLNYYSDIKRNCDIDKICGKKKAKCARIKSKEQE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctgccttcattgtttcttttctgttgttgttcatgttttttttgcagcatgatttg
actgcatcgtcaatatcacgtccatttttgttcagcgacaaaactcagtatcatcacaga
aatgaacccatcgaaaaaccgccaaattgcgaggctgttcacatcagtatggtcatacga
cacggctcaaggtatccgggaagcgtgcgagtgaaaaagatgaaagatctgctgaaagaa
atcaaccaacacttgtcaagagattctcctattcggtacaagaatctttcccttccctgg
agtataccaacggatattcttgactccgcaggcaaggagatgtcttccctgggcactgaa
gagatgtactctattggcaaacgcttgctttccaaattccccaacgcgttgcaacatggc
tactccaatttgaactatagctttattgcaactgacaaattgaggtcgagcgagagtgca
gtggctttcgcgcaaggattgtttgaaggcaaaggacatctgggcccaggaaaatatcaa
ccagttgccattaaatcctccggtccatctaacgaggacacttacttgagaatatttgaa
gcttgtcccaagtggaaaaaaagaacagcaaagggcaacagggagtatgcaaactttact
aagggtcctgaaatgcgtcgagttcttgaaaatatctccgatagactgaagctgggaaag
tcattttctgctcgtcttgaataccagtgggccgtggaaatgtttttgatgtgtgcattt
ggcattcagacagacagtgcggacacaagttggtgcgatttgtttgaagaagaggatttg
aaggttctggaatatctcaacgacttgaaactgtattgggatcgaagctacggtcgtaaa
ataaatcacagaatgagttgtcgcctttatgagaatataactgtcagtttcgatagattt
cttgaatcaggtaaaccccatggcgtctttagattcgctcatacaggaacagtcattccg
cttctgactatgttggggatgtataaggacgttgtacccctgagggccgacaattatctt
ctgcaagccacccgaaaatttcgcatttcaaatgtcgtgcccatgggtggtaacgtcgct
tttgttttgtataactgcaaaaatgagagttccatgaacttaggtgatgaggcagatgag
aagaggacattttctgtatcacaaatgaccatacaattgctggtcaacgaagccgctgta
ccaatgcctgcctgtggggggcgcatgtattgtgggcttcagaagtttctaaactactac
tccgacatcaagagaaattgtgacatcgataaaatttgtggaaagaagaaagcaaaatgc
gcgcgaattaagtctaaagagcaggaatag

DBGET integrated database retrieval system