KEGG   Acropora digitifera (stony coral): 107347297Help
Entry
107347297         CDS       T04352                                 

Definition
(RefSeq) cytosolic phospholipase A2-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00564  Glycerophospholipid metabolism
adf00565  Ether lipid metabolism
adf00590  Arachidonic acid metabolism
adf00591  Linoleic acid metabolism
adf00592  alpha-Linolenic acid metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107347297
   00565 Ether lipid metabolism
    107347297
   00590 Arachidonic acid metabolism
    107347297
   00591 Linoleic acid metabolism
    107347297
   00592 alpha-Linolenic acid metabolism
    107347297
Enzymes [BR:adf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107347297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 107347297
NCBI-ProteinID: XP_015768685
Position
Un
AA seq 671 aa AA seqDB search
MIFKNEAQTRAAQGQGEELVRCLQASPRSCIALKINVLRARNVTLGWHDWCENANQQKPL
LSISSSFYELLSFRSDHESDLRYSTDLCDEEKQFRDKRREVVYEVMKQVLGERAPRNMNE
VPTVAVLGSGGGYRATAGFSAACCALEEMGLMDCVTYLTGLSGSAWGLSLLYSQTPGSTI
SPNETRSNIREQLQWGPFWLLTPRRVMHYVKDIIEKWKQGQPVSLTDFYGHCVGESLLGP
KKDSVKLSHQKKKVECGCVPMPIYTAINSRRDISADAFAEWVEFTPYEIGMDKYGTFMKT
ELFGSKFFCGKLVEKFPESPLYYLQGIWGSFYAILLQRVIKDGGKMKEIKDNGDEKKLLV
NFMLIYTWESDNQRTYAAPCQPSQSVLLFTSGIWGSFYAILLQRVIKDGGKMKEIKDNGD
EKKLLEEQFLSDKKDSKTEDGEMDEELGKFGGKSKQKVTNSLLEKLKTAVATDEEKLKID
GKATKSQKAEKKEFRKKLLDYVMEKLPGLQTRSQRAALIHNFLRGLGLNTLQVTDGSHSQ
PYLESDNVRRKQMELIDAGLMFNSPYPPLLRKERSIDLILSFDFSARETDEERPFKNIKL
AEEWAKRNGLLFPPIDADEQYERDGMKECYVFKHPTDPACPIVLHFVLINKTYRDYRRPG
EIIYCSVNECN
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgattttcaagaacgaagcacagactagagcagcccagggacaaggcgaggagctagtg
cgctgtttgcaggcttctccgagatcctgcatagctcttaagatcaatgtattgagggcg
agaaatgttacactaggatggcatgactggtgtgaaaatgccaaccagcagaaaccctta
ttgtccatttcgagctcattttatgaactgttgtcatttagatccgaccatgaatcagac
ttgagatacagcacagatctctgtgatgaagaaaaacaatttcgagacaagagaagggag
gttgtctatgaagtgatgaagcaagtgttgggggaacgagctcctcgaaacatgaatgag
gttcccacagtagctgttcttgggtccgggggaggttaccgagccactgccggcttcagt
gccgcgtgttgcgccctagaggaaatgggtttgatggattgcgtgacctatctgaccggt
ttatccggttcggcgtggggcctttcccttttgtattcccaaacacccggcagcacaatt
agtcctaacgagacacggagtaacatcagagaacagctgcaatgggggccattttggctt
cttaccccgagaagagtaatgcattatgtgaaagacatcatcgagaaatggaaacaaggg
caaccagttagtctgacggacttttatggccactgcgttggagaaagtcttctaggaccg
aaaaaggactccgtcaaactaagtcatcaaaagaagaaagtggaatgtggatgtgtacca
atgccaatctacaccgccattaactctagaagagatatttccgctgatgcttttgcagaa
tgggtggagtttactccttatgagattggaatggataaatatggaactttcatgaagact
gaactgtttgggagcaaatttttctgcggaaaactcgttgagaaatttccggaatctccg
ctctattatctccaaggaatttggggaagcttttacgccattttgttgcagagagtgata
aaggacggaggaaaaatgaaagagataaaagacaacggggatgaaaaaaaactattagtt
aatttcatgctaatttatacatgggaaagcgataatcagagaacttacgcagccccttgt
caaccatcacaatccgttcttctttttacttcaggaatttggggaagcttttacgccatt
ttgttgcagagagtgataaaggacggaggaaaaatgaaagagataaaagacaacggggat
gaaaaaaaactattagaggaacagttcttgtcagataagaaggactcgaagactgaagat
ggtgaaatggatgaggagttgggcaagtttggagggaaatcgaagcaaaaggtgacaaat
tccctgctggaaaagctgaaaactgccgttgcgacagatgaggaaaagctcaaaatcgat
ggcaaggcgacgaaaagtcagaaagcggaaaaaaaagagttccgaaaaaagctcttggac
tacgtgatggaaaagttacccggactccaaactcggtcgcaaagagctgcgttgattcat
aacttccttcggggcttgggtctcaatacattgcaagttacagatggttcccattcacag
ccctacttggagtcagacaacgtcagaaggaaacaaatggagcttattgatgcggggtta
atgttcaactcgccctaccctcccctcctcaggaaggaaagatccattgatctgatcttg
tcttttgacttcagcgctcgggaaaccgatgaggaacgacctttcaagaacataaagttg
gcagaagagtgggccaagcggaatggtcttcttttcccgccgattgacgcggatgaacag
tacgagcgagatggaatgaaagagtgttacgtgttcaaacatcctacggacccagcctgt
cccatagtgcttcacttcgtgctcattaataagacctaccgagactatagaagaccaggt
gagatcatttactgctcggtgaatgaatgcaactaa

DBGET integrated database retrieval system