KEGG   Acropora digitifera (stony coral): 107347573Help
Entry
107347573         CDS       T04352                                 

Definition
(RefSeq) histamine N-methyltransferase-like
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00340  Histidine metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    107347573
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adf04147]
    107347573
Enzymes [BR:adf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     107347573
Exosome [BR:adf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107347573
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23
Motif
Other DBs
NCBI-GeneID: 107347573
NCBI-ProteinID: XP_015769023
Position
Un
AA seq 295 aa AA seqDB search
MKATKLSSSLETYHRTFQLVQAKSNLIEVVRDYCIRATSGFVEQLRLFPRNQVLNVLSIG
SGDGKHDIEILKTLARGLTSLDGQSSKPSIQACIVEPSSLIADFMQSVSSLPEELSNHAN
VSFQWHKVTFQEFSSASLERNNDTFHFIHFVCSLYYTEAKESLTQCFNKLERGGAILCVI
SGEESICAKLSKRDDVPISNIYTGKEIIAIAQRNNWRYEEIPTVNCQMDISDLFDENSQT
GDLMLDFLTHTINYRKTTDPVLFNEIMDLIRQSSITDEKGKTFLGSEIAAVLIYQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgactaagctgtcgtcatcgttagaaacttatcaccgcactttccagctagtc
caagccaaatccaacctaattgaagtggttcgagattactgtattcgtgcaacatctggc
tttgtggaacagcttcgtctcttccctcgaaatcaagttctcaatgtcctcagcattgga
agcggcgatggcaagcatgatattgagattctcaagactcttgccagaggtcttacctcc
ttagacggacaaagctcaaagccatcgatacaagcttgtattgtagaacctagttcttta
attgcagatttcatgcaatcagtctcgtcattaccagaggagttgtcgaatcatgccaat
gtctcgttccagtggcacaaggtgacctttcaggaattcagcagtgcttcgttggaacgg
aataacgacacgtttcatttcattcattttgtctgttcgctttactacacggaggcgaaa
gaatcactcacacaatgcttcaacaaacttgaaagaggaggtgccatactgtgtgtaatt
tctggtgaggaatcaatctgcgcaaaactttcaaagagagatgatgtgccaatcagtaac
atttacactggaaaagagatcattgctatcgcccaacggaacaattggaggtatgaagaa
attcccacggtgaactgccaaatggacatctcagatttgtttgacgaaaactcccaaacc
ggggacttgatgctcgattttctgacacacacaatcaactataggaaaacaacggatcct
gtgttgtttaacgaaattatggacttaattaggcagtcgtccatcactgacgaaaaagga
aaaacatttctgggatccgaaatcgccgctgttttgatttaccaatag

DBGET integrated database retrieval system