KEGG   Acropora digitifera (stony coral): 107348972Help
Entry
107348972         CDS       T04352                                 

Definition
(RefSeq) glutathione synthetase-like
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00270  Cysteine and methionine metabolism
adf00480  Glutathione metabolism
adf01100  Metabolic pathways
Module
adf_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107348972
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107348972
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adf04147]
    107348972
Enzymes [BR:adf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     107348972
Exosome [BR:adf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107348972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase
Motif
Other DBs
NCBI-GeneID: 107348972
NCBI-ProteinID: XP_015770550
Position
Un
AA seq 494 aa AA seqDB search
MNGLELPADNVVSLLANEGRDYCLTHGLVMGSKDSFFGVEHAPFTLLPTAFLERLFTKAK
DVQKDFNVLVHRVSQDHEFLKTALQSTIEVDSFTAKIFDIYETTRTEGLSQPISLGILRS
DYMMDCSNPRTSDLLQDEISIKQVEINTIASSFGGLSPQLRKLHKFLTTLQTGYDPKTEE
KLPKNSSCLGIATGLVDAWKYYGNENSVVLMVVQGEERNRYDQRWVQHLMAEVNPAVRMV
RKSFKDINRTGQLQEDKTLIVDGQEIAVVYFREGYDPSSYTSENDWNARLMLERSRAIKC
PSAALHLAGTKKVQQVLASPGVLERFISDKEVVNKIRSTFTGLYTLDEGLEGDKTMQLAI
ADPDRYVLKPQLEGGGNNIYGDDIVKTLADAKERSKYILMDKIQPPVARNFIVRSELPQP
VLADVISEIGFYGILISQGDEILVNREVGHLMRTKSIDHQDGMECVQGGPTWTALTWCNF
QVLLHRIRASFRET
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacttgaacttccagccgataatgtcgttagtcttttagctaacgaaggacga
gattactgtttgactcacggtcttgtcatgggttcgaaagattcgttctttggtgtagaa
catgcacccttcacccttctcccaactgcatttctcgagcgactgttcaccaaagccaaa
gatgtgcaaaaagattttaatgtgctggtgcatcgtgtcagtcaagaccacgagttcctc
aagacagcattgcagagcacaattgaggttgattcattcactgctaaaatatttgatatt
tatgaaacaacaagaactgaaggactttcacagcctatctccctcgggatccttcgatcc
gactacatgatggactgttcaaatcctcgcacttcggatttgctgcaggatgagatttcc
atcaagcaggtggagataaacaccattgcatcttcctttggtggactcagtcctcagttg
agaaaactacacaaatttcttaccactctccaaactggatatgatcctaaaactgaagag
aagcttccgaagaattcttcctgtttaggcatagctactgggctggtagatgcatggaag
tactatggaaatgaaaactctgtagtgttgatggttgtgcaaggtgaagaacggaacaga
tatgatcaaagatgggttcagcacttgatggcagaagtcaatcctgctgtgcgaatggtt
agaaaaagcttcaaggacatcaacagaacagggcagcttcaggaggacaaaacacttatt
gtggatggacaagaaattgctgttgtttacttcagagagggttatgatccttccagctat
acttctgagaatgactggaatgcgcggctaatgctggagcgatcgcgagctatcaagtgt
ccatcagctgcgcttcacctggccggcacaaagaaggttcaacaagtgttagcttccccc
ggtgtcctggaaaggtttatttcagataaagaagtggttaacaagatccgtagcactttt
acgggtctttacacactggacgagggccttgaaggtgacaaaaccatgcagttggccata
gcggatcctgatagatacgtgctaaagccgcaattggaaggagggggaaataatatttac
ggtgatgatattgttaagacgttagctgatgccaaggaacgatcgaaatacattttaatg
gacaaaatacaaccaccagtggcaaggaatttcattgtccgttctgaactgcctcaacca
gtgctggcggatgttatcagcgaaataggattttacggaattttaatcagtcaaggcgat
gagatattggtaaacagagaggtcggtcatctcatgcgtaccaaaagcattgatcatcaa
gatggtatggagtgtgttcagggagggccaacttggacagcccttacttggtgtaacttc
caagtactcttgcatagaatacgcgcgtctttccgcgaaacctga

DBGET integrated database retrieval system