KEGG   Acropora digitifera (stony coral): 107349486
Entry
107349486         CDS       T04352                                 

Definition
(RefSeq) ankyrin-1-like
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:adf03036]
    107349486
Chromosome and associated proteins [BR:adf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    107349486
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5
Other DBs
NCBI-GeneID: 107349486
NCBI-ProteinID: XP_015771148
Position
Un
AA seq 360 aa
MARQNGYTVVTDLRTNPGGTVQRRRRKQSVKIERNIDEDALMASAIGDVTWLQQSLYDTR
KVYSVSKDHGLAPIHLAAQNGQLECLRTMIEKYKVDVNFQSASGWTPLHLAINKSTKKSG
VKCVKFLLENGADPSMQTNTGITPVHQAASEGHVKCLQELIKWGAKIDTIDINGHTPIFI
ARVCAHRVCARMLANQLWYLNKQRYLVDRLEKEQQTKRLEEERHKLSLIRIAEGKNESKL
AFEQWLGKKGIPDIVTMYGPIPSEERKGVSEVRSSQSVRPSPIPIVAETAIVVRSKTEFE
SFEASPTFASRKSLEYDHDNDKKLDLIPLERISASKLRKGQRTEGLRRNMPRITKNSSIV
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcgaggcaaaacggatatacagtagtgactgatctaagaacaaatccaggcggcaca
gtgcagcgacggagacgaaagcaatccgtgaaaatagagagaaatatagacgaagatgca
cttatggcttcagctattggagatgtgacatggctacagcaaagtctctacgacacgcga
aaagtttactccgtttctaaagatcatggcctggcaccaatccaccttgcagcacagaat
gggcagcttgaatgcctcagaacaatgattgagaaatacaaagtagatgtgaattttcag
agtgcctctggctggacacctcttcacttagcaatcaacaaatcaacaaagaagagtggg
gtgaaatgtgtgaaatttctgttggaaaatggtgcagatccttcaatgcaaacaaataca
ggaataactcctgtccaccaagcagcaagtgaaggacatgtgaagtgcctacaggagctt
ataaaatggggcgccaaaatagataccattgacattaatggacacactcctatttttata
gcccgcgtgtgtgctcacagagtatgcgcacggatgttagccaaccagctatggtattta
aacaaacagagatatttggttgacagacttgaaaaggaacagcaaactaaacgacttgag
gaagaaaggcacaaattaagtttgattcgcattgcagagggtaaaaacgaaagtaaactc
gcttttgaacagtggctaggaaagaaagggatcccggatattgttacaatgtacggtccc
atcccctctgaggaaagaaaaggcgtcagtgaagtccgctcttcacagtctgtccgcccc
tctccaatcccaatagtagcagaaacggccattgtcgtccgttccaagacagaatttgaa
tctttcgaagcatcgcctacctttgcttcccggaaatctttggaatatgatcacgataat
gataaaaaactggatttaatcccactggagaggatttcggcttcgaaacttaggaaagga
caaaggaccgaagggctgcgacgtaacatgccacgaattaccaaaaattcgtctatagtt
tga

DBGET integrated database retrieval system