KEGG   Acropora digitifera (stony coral): 107351357Help
Entry
107351357         CDS       T04352                                 

Definition
(RefSeq) ketohexokinase-like
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00051  Fructose and mannose metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    107351357
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adf04147]
    107351357
Enzymes [BR:adf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     107351357
Exosome [BR:adf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107351357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 107351357
NCBI-ProteinID: XP_015773130
Position
Un
AA seq 161 aa AA seqDB search
MIAIVDEFNSKCTAHDKIVVSVELEKPRQSLMPLLDKADVVFTSKDFARFCGYSTASEAV
KVFHSKVKAGATVICPWGDEGADGIGPDGEVKHSDAYCPKEVIDTLGAGDTFVAGAIYSL
IKQSSIEDTLNFACKLAGLKCGMRGNDGVGNAIKQEHSFPI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgattgccattgtcgatgaattcaattcgaagtgcacagcccatgacaagattgtggtc
tcggtggagttagagaaaccaagacaaagtctcatgccgctgcttgacaaagccgatgta
gtctttactagcaaagatttcgcgcggttctgtggatattctacggcgtccgaagcagtt
aaagtatttcacagtaaagtaaaggctggtgctacagttatatgtccttggggagacgag
ggtgccgatggtatcggtcccgatggtgaagttaaacacagtgatgcctattgcccaaag
gaagtgattgatactcttggagccggggatacgttcgttgctggagctatttacagcctt
ataaagcagtcatcaattgaagataccctgaactttgcttgtaaattggctggattgaaa
tgtggtatgcgtggaaatgatggcgtcggaaatgcgattaaacaggagcattccttcccg
atttaa

DBGET integrated database retrieval system