KEGG   Acropora digitifera (stony coral): 107351780Help
Entry
107351780         CDS       T04352                                 

Definition
(RefSeq) cytosolic isocitrate dehydrogenase [NADP]-like
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00020  Citrate cycle (TCA cycle)
adf00480  Glutathione metabolism
adf01100  Metabolic pathways
adf01200  Carbon metabolism
adf01210  2-Oxocarboxylic acid metabolism
adf01230  Biosynthesis of amino acids
adf04146  Peroxisome
Module
adf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
adf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107351780
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107351780
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107351780
Enzymes [BR:adf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     107351780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 107351780
NCBI-ProteinID: XP_015773574
Position
Un
AA seq 455 aa AA seqDB search
MAAIAGCSRIRPLGIRNALHRLFSCTSIELQRQQRNFCHHGHATKIKVEGPVVEMDGDEM
TRVIWKMIKDRLILPFLDLDIKYFDLGLPHRDATDDKVTTEAAEAIKQYSVGIKCATITP
DEERVKEFNLKKMWRSPNGTIRNILGGTVFREPIICQKVPRLVPGWVEPIVIGRHAHGDQ
YRARDFVVNGPGVFEISFSPADGSGKLTTEVFEFTGTGGVTMGMYNTDESIREFAHSCFQ
YALNKEWPLYMSTKNTILKKYDGRFKDIFEDIYQRIYEKQFKDLGIWYEHRLIDDMVAYA
MKAPGGFVWAAKNYDGDVQSDTLAQGFGSLGLMTSVLVSGDGKTIESEAAHGTVTRHYRQ
YQKGNETSTNPIASIFAWTQGLRHRSRLDKNVELKRFCKALEKACVESVDSGYMTKDLAG
CIYGLSNVKRDQYCSTEEYFDAVEKKLTELFQPAS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaattgcaggttgctctcgcattcgtcctttaggaatacgaaatgctttgcat
cgcctgttttcctgcacctctattgaacttcagaggcagcaaaggaacttttgtcatcat
ggacatgcgacaaaaattaaagttgagggtccagttgtggaaatggacggagatgaaatg
acgcgtgtcatttggaaaatgattaaagacaggttgatcttacccttcttggatctggac
atcaaatattttgatcttgggctgccacatcgtgatgcaacagatgataaagtgaccaca
gaagcagcagaagccataaaacagtacagtgtaggaattaaatgtgcaacaatcactcca
gatgaagaaagagtaaaagaattcaatttaaaaaagatgtggcgtagtcccaatggtaca
attcgtaacattttgggtggcacagttttccgtgagccaatcatctgccagaaggttcca
agacttgttccaggctgggtggagcccattgtcattggaagacatgctcatggtgatcaa
tatcgtgctagagactttgtggtgaatgggcctggagtgtttgaaatctccttttcccca
gctgatggcagtggcaaacttaccactgaggtgtttgagttcactggtactggaggtgtg
actatgggcatgtataacactgacgagtcaatcagggaatttgctcatagctgcttccaa
tatgccttgaataaagagtggcctctttatatgagcaccaaaaacaccattctgaagaag
tatgatggcagattcaaagacatctttgaagacatctatcagaggatttatgaaaaacaa
ttcaaagacttagggatttggtatgaacacagacttattgatgatatggttgcctatgct
atgaaggcaccaggtggatttgtttgggctgcaaagaattatgatggagatgtccaatct
gatacacttgctcaaggttttggttcccttggtcttatgacaagcgtgcttgtctctgga
gacgggaaaacaattgagtccgaggctgcacatggtaccgtgactaggcactacaggcaa
tatcaaaagggtaacgaaacaagcacaaacccgattgccagtatttttgcttggactcaa
gggctgcgtcaccgctcaagacttgacaagaacgttgaactcaaaagattttgcaaggct
ctagaaaaggcgtgtgtggaaagtgttgattcggggtacatgacaaaagatcttgctggt
tgtatctatggacttagcaatgtaaaacgtgaccagtattgttcaactgaagagtacttt
gatgctgtggagaagaaattaactgagctgtttcagccggcttcctga

DBGET integrated database retrieval system