KEGG   Acropora digitifera (stony coral): 107352450Help
Entry
107352450         CDS       T04352                                 

Definition
(RefSeq) activin receptor type-1C-like
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04068  FoxO signaling pathway
adf04144  Endocytosis
adf04350  TGF-beta signaling pathway
adf04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:adf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107352450
   04068 FoxO signaling pathway
    107352450
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107352450
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107352450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:adf01001]
    107352450
Enzymes [BR:adf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107352450
Protein kinases [BR:adf01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107352450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TMEM154
Motif
Other DBs
NCBI-GeneID: 107352450
NCBI-ProteinID: XP_015774269
Position
Un
AA seq 546 aa AA seqDB search
MPVLEKAALVFIAVLFHTASCLTGQNNMSTVFSLNTTNSTEMPTSPSAKIKCFCSISGCK
KSNRTCSAKLGCFSARLSEQVVKKGCFDGDLYQKTTCQNAMNLVNCCYKSWCNWNNTPPF
ITEQPTNSSKRNHLNEEDQGLDFILLSIFSPLAVLVLLIVVMCLVYKHLQRRQLRKDRYP
NLGYSRHSSSGNKLLECWSCQSESDLHPLAQRTSAQDLDLITLIGNGKFAKIWRGLWHGD
DVAVKLFHPSTVDLFNNEVSINNVVGNHQNILRLQHSHSAFSWNQISYSCIVTEYHDNGS
LFDFINRRTVNIQEMFSLALSAARGLSHLHGEIYQKDETFSIAHCDIKSKNILVKANLTC
AIGGLGFAVVDKWKEEISLKKKHRGTPRYMAPEILDDTVFKSFESYKRADMYSFGLVLWE
IVRRTSIEGKILEAYALPYHDMVPADPTVEDMKKVVIAQQKRPFVPNRWSENSVLESVVK
MIKDCWKQNAPARLSSLRVKKNLSKLMDMVKPAPSNTALSEEYAVISDVNIHIPETFIEN
HTSVKA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtccttgaaaaagctgccctcgtatttatcgccgtccttttccacacagcgtcg
tgtcttacaggacaaaacaacatgtcgacagtgttttcattgaacacaaccaattctaca
gagatgcctacatccccttcagcaaaaattaagtgtttttgcagtattagtgggtgcaaa
aagtctaatcgaacttgcagtgcaaaactgggctgtttttcagcacgcctgtcagagcaa
gttgtcaagaaaggctgctttgatggtgatttgtatcaaaagacgacttgccagaatgca
atgaaccttgttaactgttgttataagagttggtgtaattggaacaatacccctccattc
ataacggaacaaccaactaattcctcaaagaggaaccatttaaatgaagaggaccagggt
ttagatttcattctgctgagcatcttttcaccgctagctgttcttgtgctcctgattgtc
gtcatgtgcttggtttataaacatctgcagaggcggcagctccgaaaagacaggtaccca
aaccttggctacagcaggcattccagttcaggtaacaaactgctagaatgttggtcgtgt
cagagtgaatctgacctgcacccgctggcccagcggacatcagcgcaagatctagactta
attacactgattggcaacggcaagtttgcaaagatatggagaggcctttggcatggagat
gatgtggctgtcaaactctttcaccccagcacagttgacttattcaacaatgaagtcagc
attaacaatgtggttgggaaccatcagaacattctcaggcttcagcactctcacagtgca
ttttcttggaatcaaatcagttacagctgcattgtaaccgaatatcatgacaatggatct
ttgtttgactttatcaatcgtagaactgttaatatacaagaaatgttctccttagctctc
tctgcggctcgaggtttaagtcacttgcatggagagatttatcaaaaagacgaaacattt
tcaatcgctcactgtgatattaaatctaagaacattttggtgaaggcaaatcttacttgt
gcaattggaggcttgggatttgctgtggtggataaatggaaagaagaaatcagcttgaag
aaaaagcacagaggtacccctcgttacatggcgcctgaaatcctagatgacactgtattt
aagtcattcgagtcttacaagagagctgacatgtattcgtttggtcttgttctgtgggag
attgtgagaagaacttcaattgaaggtaagatacttgaggcatatgcattgccttatcat
gacatggtaccagcagatccaacagtggaggacatgaaaaaggttgtgattgctcaacag
aagagaccatttgtacccaacaggtggtcagagaatagtgtacttgagtctgttgtgaaa
atgataaaagattgctggaaacaaaatgctccagcaaggctgtcgtcactcagagtaaag
aagaacttgtcaaagctaatggatatggtcaaaccagctcctagcaatacggccctttcg
gaagaatatgcagtaatatcagatgtgaatattcacatcccagagactttcattgaaaat
cacacctctgtcaaggcatga

DBGET integrated database retrieval system