KEGG   Acropora digitifera (stony coral): 107352743Help
Entry
107352743         CDS       T04352                                 

Definition
(RefSeq) N6-adenosine-methyltransferase 70 kDa subunit-like
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:adf03019]
    107352743
Enzymes [BR:adf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     107352743
Messenger RNA biogenesis [BR:adf03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     107352743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 DUF2861
Motif
Other DBs
NCBI-GeneID: 107352743
NCBI-ProteinID: XP_015774534
Position
Un
AA seq 586 aa AA seqDB search
MSDTWTEIQEHKRRQGSLRDHLSRRRQERKGLSVQDTDTLVGNKVVSTGVTKRKHCRPAL
RDFGRGIKLKCASTPPPENSLTPSEDVPVGNKLQDKVVKVDPLLETRLSEYLCNPSRNVP
VDSLLLANSLSEECGNDVSHEALQSLLQKFAIQDFISIKQGTSQDGMPCTIIISIDHLKL
DAVQRDKTLKEDESTSKKRKRESNFNDLASSPAAPEVAKPKLESADDIESLLSMPTMKEM
ESKKVGEEILDLLNVPSHKEQWTVEKFKSQGGAFVHEFCDHGTRADCRRNNPQRQPCRKV
HFRKIIQKHTDECLGDCSFLNTCFHMDTCKYVHYEVDYSDVEMNKEDKGKDKKKDEKTSL
ANTVEGDNRVTLYPPQWIQCDMRYFDMTVLGKFSVVMADPPWDIHMELPYGTMSDDEMRK
LDVPSLQDEGYIFLWVTGRAMELGRECLKLWGYERCDELIWVKTNQLQRLIRTGRTGHWL
NHGKEHCLVGVKGDCKNFNRGLDCDVLVAEVRQTSHKPDEVYGVIERLAPGTRKIELFGR
QHNVQPNWITLGNQLDGVRLLDPEVTARFKKRYPNGIVLNTSSTKI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacacctggacagaaatacaagaacacaagcgtcggcaaggaagtcttcgcgat
cacctttcccggcgaagacaggaacgtaaaggactcagtgttcaagataccgacacatta
gtggggaacaaagtggtctctacaggagtcacaaagaggaaacattgcaggccagctctc
agagattttggaagaggcattaaattgaaatgtgcatcaacacctccaccagagaactca
ctaactccatcagaggatgttccagttggtaacaagctgcaagataaggtggtcaaggtt
gatcccttgctggagactcggttatcagagtatttgtgtaatccatcaagaaatgttcca
gtggattctttgctactggcaaactcactttcggaggagtgcggcaatgatgtttcccat
gaagcactacagagcttgttacagaagtttgccattcaagactttataagtatcaaacaa
ggaacatcacaagatggaatgccttgtacaataattatatcaatagatcatctcaagctg
gatgctgttcagcgggacaaaactttaaaagaagatgaatcaacttcaaagaaaaggaaa
agagaaagtaattttaatgacttggcatcatcaccagcagctccagaagtggcaaaacca
aaacttgagtcagctgacgatattgagagtcttttatcgatgcccacaatgaaagagatg
gaaagcaaaaaagtgggtgaagaaattttggatctccttaatgtcccttcacataaggag
caatggactgtagaaaagttcaaatctcaaggaggagcatttgttcacgagttctgtgat
catggtacaagagcagactgcagaagaaataacccacagagacagccttgcagaaaggtt
cattttaggaagatcattcagaagcatacagatgaatgccttggtgactgttctttccta
aacacgtgttttcacatggatacatgcaagtatgtccattatgaagttgattacagtgat
gttgagatgaataaagaggataaaggaaaagacaagaaaaaggacgaaaaaacttcactg
gcaaacaccgtagaaggagacaacagagtaacactttacccaccgcagtggattcagtgt
gacatgagatattttgatatgacagtgttgggcaagttctctgttgtaatggctgaccca
ccgtgggatattcatatggagcttccctatggcacaatgtcagatgacgaaatgcggaag
ttggatgtcccgtcccttcaagatgagggatatattttcctttgggtaactgggcgtgcc
atggaattaggccgtgaatgtttgaagctttggggttatgagcgatgtgacgaactcatc
tgggttaaaacaaatcaactgcagcgactgattaggacaggaagaactggacattggctt
aatcatggaaaagaacactgtctggttggcgtaaaaggagattgtaaaaactttaacaga
gggttggactgtgatgtgcttgttgctgaggttcgacaaacaagccataagcctgacgaa
gtctatggtgtgattgagcggctggcgcctgggactagaaaaatcgagctgtttggtaga
caacacaatgtgcaacctaactggataactcttggaaatcaactggacggggttcgcttg
cttgatccagaagttaccgcacggttcaagaaacgttatccaaacggaatcgtccttaat
acgtcatctaccaagatatga

DBGET integrated database retrieval system