KEGG   Acropora digitifera (stony coral): 107354360Help
Entry
107354360         CDS       T04352                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00561  Glycerolipid metabolism
adf01100  Metabolic pathways
Module
adf_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    107354360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:adf01002]
    107354360
Enzymes [BR:adf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107354360
Peptidases [BR:adf01002]
 Serine Peptidases
  Family S33
   107354360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 LIDHydrolase PGAP1 DUF2920 Peptidase_S15 Peptidase_S9 PAF-AH_p_II Thioesterase Ser_hydrolase OKR_DC_1_N LCAT
Motif
Other DBs
NCBI-GeneID: 107354360
NCBI-ProteinID: XP_015776315
Position
Un
AA seq 244 aa AA seqDB search
MEVEVISEEGYVHSSKGLKLFSKCWKLKEGTPRALIFVSHGVGEHCSKYEEFAHVLAKQG
LLVISHDHVGHGRSEGEPVQISSFSIYVADVLKHIDELSESNAGLPVFLLGHSMGGTISI
LCAMERPQFFAGLVLCAPAILANPKTATRFMIFLGRVVSYVAPSFQVVRSEDYSALTRDP
EQVMPITLNNPLNLRVKFSFNRFRNFEDAMVNLVSRSWKIFEMIIAMFCKWVYIYRLTHS
ASEL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcgaggtcatatccgaggaaggttatgtacatagttcaaagggtttgaagttg
ttctccaagtgttggaaattaaaagagggaactcctcgtgctctgatatttgtgagtcac
ggcgttggagaacactgttctaagtatgaagaatttgcacacgtactagccaagcaaggc
ctccttgtcatctcccatgatcatgttgggcatggtagaagtgaaggagaaccggtgcaa
atatcatcatttagcatttatgttgctgatgttcttaagcatattgatgagttgtctgaa
agtaatgcaggattgcctgtctttctgcttggtcattcaatgggaggtaccatttccata
ctttgtgccatggaaaggcctcagttctttgctggacttgtgctctgtgccccagcaata
ttggcaaacccaaagactgcaactcgcttcatgatatttttgggaagagtagtttcatat
gttgcaccatcatttcaagttgttagatctgaagattattctgcacttactagagaccct
gaacaggtaatgccaattaccctcaataatcctttaaacttgagggtaaaatttagtttt
aacagatttaggaactttgaagatgctatggtaaatttagtgtcaagatcctggaaaatc
tttgagatgataatagcgatgttttgtaaatgggtttatatttacaggttaacacactcg
gcgagtgaattatag

DBGET integrated database retrieval system