KEGG   Acropora digitifera (stony coral): 107355776Help
Entry
107355776         CDS       T04352                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:adf04131]
    107355776
Membrane trafficking [BR:adf04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107355776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 Pec_lyase_C
Motif
Other DBs
NCBI-GeneID: 107355776
NCBI-ProteinID: XP_015777841
Position
Un
AA seq 1009 aa AA seqDB search
METVKMAAQSSGGSQSSGSTRAFAQKLSKFRRNGSSSSGTLSGLTKSPSTSSSFLHFATG
TIPLNEVVEPPDFEDIVLAHQPFNENDPNSKMLEFPDDDLEVTTINRQCRTVQPCFPSDT
GIENNPQLKDCIHCYSADWAIVNRRYQFRCSDEGKPDSRRKIVRSPSFVKSLPVQVYEID
EKGKLSEQGKSASQLKLNQGKENIFDLQSCSPDPLLPSVLERTPAEEVDLANEEDRGLFR
IHSLFSIYSVQQEEGIERRVPATIPQEHFGQRILVKCLQLKLELEVEPIFASMALYDGKV
KKKCLFGKSSTSAMQSEAWSAVTYHNKTPDFYEEVKVKLPAHLTVEHHLLFTFYHISCSA
GKKADDKMATETPIGYTWIPAVKEGRLSLGEFHLPVSLEKPPPSYSMLSPEVPLPGMKWL
EGHKGVFHVAVRAVSSIHPQDLHIQKFLKTCHQIEGRVTSSPNRTAEGNLESALRKSIVD
LCKAREEPLVRFLYLVLDKLILLLVRPPIISGTVVNIGQAAFESLTQIVDRLHQLLEKKG
QSPSSESRLRWRKDQTQWRQAADQQDRLRPEAEVTSQIEGSLAAEVSSIVLDSLEHLVQT
VTTSDSLRVVLSGILRVLLHCLNCNQSEIVLQNMFATQRSIVYKFPELLFEDDTELCADL
CSRLLNHCSSAISSIRAQASSSLYLLMRKKLSEAFGKIIQTEGKRMLGTYFRVGFYGSKF
GDLDGEEYIYKEPAITKLPEVSHRLQAFYGAKFGADVVEVIKDSNAVEQDKLDPEKAYIQ
LTYVDPYFDEYELKDRITYFDKNFNLRRFKYDTPFTPSGKAHGELVTQYKRKTILTTANS
FPYVKTRINVVHREQIVLSPIEVAIEDMEVRTKDLVNAVQQEPPDAKMLQMVLQGSIGAT
VNQVGTQADLSIFFLWFVSKWFLIMIILDSFKEFVKRCGDALQKNKHLIQQDQRAYQKEL
ERNYIKLTEKLEPLLKNKFGSLRGSMRQKEGSALLRKISMSFSAGHSVA
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggagacagtcaaaatggccgcccagagttcaggcggtagccaaagttcaggttctacg
agagcttttgcccaaaaactcagcaaattccggcgaaatggctcaagctcctctggaacc
ctgtcaggcctcactaagtcaccttcgacatcaagttcgttccttcattttgctacggga
acgattccactcaatgaagtggttgagccaccagattttgaagatatcgtattagcacac
caaccattcaatgaaaatgatcccaacagtaaaatgctggagtttcccgatgatgactta
gaggtgaccacaatcaacagacagtgtcgcacagtccagccatgttttcctagtgatact
ggaattgaaaacaatccccagctgaaagactgcatccactgttactcagctgactgggca
attgttaatcgcagataccaattccgttgttctgatgaaggaaaaccagactcaagacgc
aaaatagtgcgatcacctagttttgtaaaatcacttcctgttcaagtttatgaaatagat
gaaaagggaaaactctcagagcagggcaaaagtgcatcccaattaaaattaaaccaagga
aaggagaacatttttgatctgcagtcctgcagcccagaccctctattgccatctgttctt
gagcggaccccagcagaagaagtggaccttgccaatgaagaggaccgcgggttgttcagg
atccattctctattttctatttattctgtccaacaggaagagggaatagagaggagagtt
ccagcaaccattcctcaggagcatttcggccagaggattttagtcaaatgtctgcaactc
aagttagagttggaagtggaaccaatttttgcttctatggccctgtatgatggaaaagtc
aagaaaaagtgtttgtttggcaagtcaagcacctcagcaatgcaatcagaagcttggtca
gcagttacgtaccacaacaagacgccagacttctatgaggaagtgaaggtcaagttacca
gcccacctcacggtcgagcatcatttgcttttcacattttaccacatcagctgctcagct
ggcaagaaagcagatgataaaatggccactgaaacacctattggatacacgtggattcct
gctgttaaggaaggccggctgtctctaggggaatttcatcttcctgtgtcattggagaaa
cctcccccaagttacagcatgctctcaccagaggttcctcttcctggaatgaaatggctt
gaaggtcataagggtgtgttccatgttgctgtgagagctgtgtcttcgatccatccacag
gatttgcatattcaaaaatttctcaagacctgtcatcaaatcgaggggcgcgtgacgtca
tcacccaaccgtaccgctgaagggaacttggaatctgcgctgaggaaaagcatagtcgac
ctgtgcaaggcgcgcgaggaaccattggtgcggtttttataccttgtattggataaactg
attttgctccttgtcaggccgcctattatatctggaactgtagtgaatattggccaagca
gcgtttgaatcgctcacacagattgttgaccggctgcatcagttactggaaaagaagggc
cagtcaccaagctctgagtcgagattaagatggcgaaaagatcagacacaatggagacaa
gctgctgaccaacaggacaggctacgccctgaggcagaagtcacttcccaaattgaaggt
tctctggcagctgaagttagttcaattgtgcttgattcactggaacacctcgttcagact
gtgacaacctcggactcgcttcgtgtggttctgagtggaattctgagggtgctgctgcat
tgtctcaactgcaatcagagtgagatcgttttgcaaaacatgtttgctacacagaggtct
attgtttataagttccctgagttactattcgaagatgacacggagctatgcgcagacctg
tgctccaggctccttaatcactgcagctcggccatcagcagtattcgggcccaagccagc
tcatctctctatcttttgatgagaaaaaaactatccgaagcgtttggcaagattatacaa
acggaaggaaagcgtatgctggggacgtatttccgagttggattttatggatctaagttt
ggtgatcttgacggtgaagagtacatttacaaagaaccagcgattacaaagctgcctgag
gtttcacatcgactccaggctttttatggcgcaaagtttggcgcagacgttgtggaagtg
atcaaagattccaatgctgtcgaacaggacaaacttgatccagaaaaagcctacattcag
ctgacatatgtggatccttactttgatgagtatgaactgaaagaccgtataacttacttc
gacaagaattttaatttgaggcgatttaagtatgacacaccgttcactccgagtgggaaa
gcacatggggagcttgttacacagtacaagagaaagaccatcctaacaactgccaattca
tttccttatgttaagacaagaatcaacgttgtacaccgagaacagattgttctcagtcct
attgaagttgcaattgaagatatggaagtgaggaccaaagatcttgtgaatgcagtgcaa
caagaaccgcctgatgccaagatgctgcaaatggtattgcaggggtccattggcgccaca
gtcaatcaggttggtacacaggcagacctaagtatatttttcctatggtttgtaagtaaa
tggtttctgatcatgataatcctggattcattcaaggagtttgtgaaaaggtgtggcgat
gcactgcagaagaacaagcacctgattcaacaggaccaacgtgcttatcaaaaggaactt
gaaagaaattacattaaactaacagaaaaacttgaacctctcttgaagaacaagtttgga
tcactgcgcggatcaatgagacaaaaagaagggtctgctttactgagaaagatctccatg
agtttcagcgctggacacagtgtcgcttag

DBGET integrated database retrieval system