KEGG   Acropora digitifera (stony coral): 107355927Help
Entry
107355927         CDS       T04352                                 

Definition
(RefSeq) beta-hexosaminidase subunit beta-like
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00511  Other glycan degradation
adf00520  Amino sugar and nucleotide sugar metabolism
adf00531  Glycosaminoglycan degradation
adf00603  Glycosphingolipid biosynthesis - globo and isoglobo series
adf00604  Glycosphingolipid biosynthesis - ganglio series
adf01100  Metabolic pathways
adf04142  Lysosome
Module
adf_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107355927
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    107355927
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    107355927
   00604 Glycosphingolipid biosynthesis - ganglio series
    107355927
   00511 Other glycan degradation
    107355927
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107355927
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:adf03110]
    107355927
Enzymes [BR:adf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     107355927
Chaperones and folding catalysts [BR:adf03110]
 Intramolecular chaperones
  Others
   107355927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 107355927
NCBI-ProteinID: XP_015778023
Position
Un
AA seq 494 aa AA seqDB search
MVRAIILLSCVVFACNAVQRFPKLSDPFALGGLGWELEELQVEDYVKGSVWPKPQGETQN
GSVYSLSSETFKFSITAQSSDVLEDAIKRYKQLTFPEDFREIKTNLPQITQLTIEVIDKY
ENLTLDSDESYKLTVVSPTSSLISYTVWGALRGLETFSQVVYQDPNGYYLANGTQIDDYP
RFKHRGFLIDTSRHFVNVPVILKFLDALSYSKFNVLHWHIVDSQSFPFVSETFPQLSNKG
AWNNKTHIYSKDDVAKIIEYARLRGIRVVPEFDTPGHTFSWRSITNLLTPCYSGGKPSGA
LGPINPTIESNYDFLQEFFKEVAERFPDNYVHLGGDEVPFSCWQSNPNITAWMNMKGFKQ
NYSLLEQYYEQKVDAVVTAFSCHLICILGSISGLSSCYYKCDPTDFTGTDEQKELVIGGT
GCMWGEWVDGTNLLTRTWPRALAVGERLWSSASVTDLTDAENRLWEHRCRYVRRGIPAEN
GIQSKYCRYEWPGF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggttcgagcgattatccttctgagctgcgttgtgttcgcttgcaatgctgttcaaagg
tttccaaaactctcagaccccttcgctctcggtggtttaggatgggaactagaagaactc
caagttgaagactacgtcaaaggttctgtctggcccaaaccgcaaggagaaacacaaaat
gggagcgtttactcgttgagctcggaaacgttcaaatttagcataactgcgcaaagcagc
gatgtgcttgaggatgctataaagcgttacaaacagttaacgtttcctgaagacttccgt
gagataaagacaaatttgcctcaaattacgcaactcacgatcgaagtgatagacaaatac
gaaaatctcactctggattccgacgaaagctataaattgaccgtcgtctcccccacgtca
tctcttatttcttacactgtctggggagcattacgagggcttgagacattcagccaagtg
gtctatcaggatccaaatggttattatcttgccaatggaacgcagattgacgactatccc
cggttcaaacacaggggtttcttgattgacacctcacggcactttgtgaatgtacctgta
attcttaagttcttggatgctttgtcatatagtaaatttaatgttcttcactggcacatt
gtggattcccaatcctttccatttgtgagtgagacattcccacagttgagtaataaggga
gcatggaataacaaaactcatatttactccaaagacgatgttgcgaagatcatagagtat
gcaaggttgagaggaattcgagtggtgccagagtttgacaccccaggtcacactttctct
tggaggagtataactaatctgttgactccatgttactcagggggaaaaccatcaggagca
cttggtcctatcaacccaacaatagaatccaattatgatttccttcaagaatttttcaag
gaagttgctgagagattccctgacaattatgtccatcttggaggtgatgaagtccccttc
agttgctggcagagcaacccaaacatcacagcttggatgaatatgaagggattcaaacag
aactattctctgctggagcagtactatgagcaaaaggttgatgcagtggtaacagcattt
tcctgccacctaatatgtattctgggttcaatttctggtctttcatcatgttattacaag
tgtgatcctacagatttcacaggtacggatgagcaaaaggagttggtcattggtggaact
ggctgcatgtggggagaatgggtcgatggcacaaacctgctcacaaggacctggcctcgt
gcattagctgtgggtgaaagattgtggagtagtgcaagcgtaacagatctcacagatgca
gagaacagattgtgggaacatcgctgccgctatgtcaggcgcggtattccagccgagaat
ggaatccagtccaaatactgccgttacgaatggccaggcttctga

DBGET integrated database retrieval system