KEGG   Acropora digitifera (stony coral): 107357789Help
Entry
107357789         CDS       T04352                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme 1-like
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00564  Glycerophospholipid metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107357789
Enzymes [BR:adf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     107357789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PSDC PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 107357789
NCBI-ProteinID: XP_015779917
Position
Un
AA seq 454 aa AA seqDB search
MSSRPYRVGQWLPSDPKVFDEWLAILITKVKADPIYRGKLQALEARDPPDESEESAEKAT
FKSSSLPLSVTLYPLHEPVEKLVQAILSDPEINMFFHQMFWQQYVLPDSSEGVKIPDWRL
MIVLIDYIMTTAPEFNETGLVGFPINVILNWPMNTTAGFAAFLNDKVNKLFKNILNYWAD
TWLSTPASCSVLTTKSPGGWFSEEAMKAMPGFDKDYECDPKLPHYGFKSWDEFFTRKFRP
GRRPVASPDDNYIVANACESAPHKLARGVKRRDLFWIKNQRYSLDFILNMNPEAKKFYGG
TVYQAFLSATSYHRWHSPVSGIIHKTELVDGSYYSQTHNIQNDPASPNMSQGYLAQVAAR
GIIYIQADNEHIGLMCFVSIGMSEVSSNEITVKEKQRVEKGDELGMFHFGGSTHLLIFRP
EVDIHFDLAGQEPGLHSTNINVKAKIAEVKKPKK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagctccagaccttatcgcgttggacaatggcttccttccgatcctaaagtctttgac
gaatggttagccatcttgatcacaaaagtcaaagctgacccgatctaccgaggaaagtta
caggcgcttgaagctcgagatcctccagatgaaagtgaagaaagcgctgaaaaagccacg
tttaaatcttcgtctctacctctgtcagtcacattataccctctccatgaaccagttgaa
aaattggtgcaagctattctcagcgaccctgagatcaacatgttcttccatcaaatgttc
tggcaacagtatgttctccccgatagttcagaaggagtaaaaattccagactggcgcttg
atgattgtattgatcgactacatcatgacgactgctcctgagttcaacgaaactggtttg
gttggcttccccatcaatgtaatcttgaactggccgatgaataccaccgctggctttgct
gctttcctcaacgacaaagtcaacaaattgttcaagaatattctcaattactgggcagac
acatggctgagcactcccgcttcttgctctgttttgaccacgaagtcacctgggggttgg
tttagcgaagaggcaatgaaagcaatgccaggctttgataaagattatgaatgcgatcca
aagctacctcattatggcttcaagtcatgggatgaatttttcaccagaaagtttcggcct
ggtagacgtccagtagcttctccagacgacaattacattgttgcaaacgcctgcgagtcg
gcgccgcacaaattagctcgtggcgtgaagcgcagggacctcttttggataaaaaatcag
cgatactcgttggatttcatcctgaacatgaatccagaagccaagaaattttacggtgga
actgtgtaccaagcgtttctgagcgctaccagttatcaccgatggcacagccctgtctct
ggcatcatccacaaaacagagcttgtggatggctcctactactcccaaacccacaacatc
cagaacgaccctgcatcaccgaacatgtcacagggttacctggctcaggtagctgcaaga
ggaatcatttacattcaagctgacaacgagcatattggcttgatgtgttttgtatcaatc
ggtatgtcagaagtgtctagcaacgaaattactgtcaaagagaagcagagagtggagaaa
ggtgacgagcttggcatgtttcactttggtggttccacacatttgctgatattccgtcct
gaagtggacatccactttgatttggctggtcaagaaccaggtctgcattcaacaaatatt
aacgtcaaagctaagatagcagaagtgaaaaagccaaagaagtaa

DBGET integrated database retrieval system