KEGG   Acropora digitifera (stony coral): 107358133Help
Entry
107358133         CDS       T04352                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta chain-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:adf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107358133
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:adf01001]
    107358133
Enzymes [BR:adf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     107358133
Protein kinases [BR:adf01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   107358133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 107358133
NCBI-ProteinID: XP_015780248
Position
Un
AA seq 327 aa AA seqDB search
MRFEDVYEVKELLGKGSFAEVKKCVNRRTSQLFAVKEVQYKNAEEREKVEQESEILERLD
HCGIVRLEQVFYAEGKVLMVLEYLPGGDLFDGLVSRPFYSEKDACACVRQVILALNYLST
VGYPPFWNEKVEFLLLSILQGNYSFPSPYWDAVSESAKDLITKMLTVNPDERMSASEALR
HEWIAQGDFVPSLHRRSTLVRLTAFNARRKLRGVVLGVIARKRLTFTPPSKSEVRSRRRD
SYIPDIQLEQEAQEILSLKEKECDGQRLEKIDEGAIKHETSLSAPSREYLVTDIKARRNR
QFRSSVYVKVKGKDGRPRSRRNPTDDN
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagatttgaagatgtttatgaagtgaaagagctgcttggcaaaggatcctttgctgaa
gttaagaagtgtgttaatcgaagaacgtctcagctgtttgcggtgaaagaagttcagtac
aaaaatgcagaagagcgggaaaaggtcgagcaagaatcagagatattggaacggttagac
cactgcggtatagttcgactagagcaagtgttttacgcagaaggaaaggtgctgatggtg
ttggagtatcttcctggtggagacctctttgacggtctggtgtcgagacccttctacagt
gagaaagacgcatgcgcgtgtgtgaggcaagtcatcctcgcgctgaactacctgtcgacg
gttggatatcctccattctggaatgagaaagttgagtttctgctattaagtattctacaa
ggaaactactcgtttccttctccatattgggatgcagtttctgaatcagctaaagatctg
attacaaaaatgctgacagttaatcctgatgaaagaatgtctgcgtctgaagctcttcgt
cacgaatggattgcacagggagattttgtcccctccctccacaggcggtccacactcgtg
cgactcactgcgttcaacgcccgccgaaagttaagaggagtagttttaggagttattgca
cgcaagaggctcacttttactccgcccagtaaaagcgaggtacgctcgagaagaagagat
tcctacatacctgacatacaactggagcaagaagctcaagaaattttgtcgctcaaagaa
aaggagtgtgatggacagagacttgagaaaatcgacgaaggagccattaaacatgaaacc
agcttatcagcaccttccagggaatatcttgtaacagacatcaaagcaagaagaaatcga
caatttcgaagttctgtgtacgtgaaagtcaagggaaaagacggaagacctaggagtaga
aggaaccctactgacgataattaa

DBGET integrated database retrieval system