KEGG   Acropora digitifera (stony coral): 107358286Help
Entry
107358286         CDS       T04352                                 

Definition
(RefSeq) cyclin-dependent kinase 10-like
  KO
K02449  cyclin-dependent kinase 10 [EC:2.7.11.22]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:adf01001]
    107358286
Enzymes [BR:adf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107358286
Protein kinases [BR:adf01001]
 Serine/threonine kinases: CMGC group
  CDK family
   107358286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like RIO1 APH Kdo
Motif
Other DBs
NCBI-GeneID: 107358286
NCBI-ProteinID: XP_015780395
Position
Un
AA seq 180 aa AA seqDB search
MEKEPDNQGTVLTSIKTLEKIIVPKEHCYGSCRPVTEFEKLNRIGEGTYGVVYRARDTVS
DEIVALKKVRMEKEKDGIPLSGLREISLLLHLEHKNIVQLKEVVVGKHLDSIFLVMEYCE
QDLASLLDNMASPFKEAQIKCLILQLLHGVQYLHDQFIVHRDLKVSNLLLNGKGVLKVGE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaacctgacaaccaaggaactgtcctgacatcaattaaaacacttgaaaag
attatagtcccaaaggagcattgctatggcagctgcagaccagtcacagagtttgaaaaa
ctcaatcgaattggagaaggaacatatggcgtggtctatcgggccagagatactgtctct
gatgaaatagttgctctgaagaaagtccgtatggaaaaagagaaagatggtatacctcta
agtggattgcgagagattagtctattgttgcacctggaacacaagaatattgttcaactc
aaagaagtagttgtgggtaaacatttggatagcatcttccttgttatggagtattgtgag
caggatttagctagcttgttggacaacatggcatcaccattcaaagaggcacagattaaa
tgcttgatattgcagcttcttcatggagtgcaatatctacatgatcagtttattgttcat
agagatttaaaagtatcaaatcttttgttgaatgggaaaggagttcttaaagtaggtgag
taa

DBGET integrated database retrieval system