KEGG   Acropora digitifera (stony coral): 107358390Help
Entry
107358390         CDS       T04352                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf00520  Amino sugar and nucleotide sugar metabolism
adf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107358390
Enzymes [BR:adf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     107358390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 NmrA RmlD_sub_bind NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 107358390
NCBI-ProteinID: XP_015780485
Position
Un
AA seq 264 aa AA seqDB search
ISQRVLNDLKKDVEKYNIEMFNEKLKPLELRIQNLESKESKYLPVKYLAEKDRKRILVTG
GAGFVGSHLVDALLIAGHEVTVVDNFFTGRKRNIEHWIGHENFELLNHDVVEPLLLEVDQ
IYHLASPASPPNYMYNPIKVTQKGVHLGSCLGETKERLDINTLLGLGYNYKFVSSSGNKD
KGNPGEYTIMQFAEMIRDAVGGKTPILNLNKMQDDPQRRKPDITRARTILGWEPKVPLNV
GLNRTIEYFKRELFKSKKSKLVDL
NT seq 796 nt NT seq  +upstreamnt  +downstreamnt
aatctctcaaagagttttaaatgatttgaaaaaagatgttgagaaatacaatattgagat
gtttaatgagaaattaaagccattggagctcagaattcaaaatttagaaagcaaggaaag
taaatatctacctgtaaagtatttggcagagaaggatcgcaaaagaatattagtaacagg
tggtgcaggatttgtgggatctcacttggttgatgccttgttgatagctggccatgaggt
cactgtggtagataacttttttacagggagaaaaagaaatatagaacactggattggaca
tgaaaattttgagcttttaaatcatgatgttgtagaaccacttttgttagaagttgatca
gatttatcatttggcctctccggcatcaccaccaaattatatgtacaatcccattaaggt
aacgcaaaaaggtgtgcacttgggaagttgtcttggggaaacaaaggaaagacttgatat
aaacactctgctgggactaggatacaactacaagtttgtatcttcctcgggaaacaagga
caagggaaacccaggcgaatacacaatcatgcaatttgctgaaatgattcgagatgctgt
aggtggaaaaacgccgattttgaatctaaacaagatgcaggacgatccacagaggcgcaa
gcctgacataactcgagcgaggaccatacttggatgggaaccgaaggttcctttaaacgt
tggccttaaccggacgatagaatacttcaagagagaactgttcaaatcaaagaaatccaa
gcttgttgacttgtag

DBGET integrated database retrieval system