KEGG   Ammonifex degensii: Adeg_0107Help
Entry
Adeg_0107         CDS       T00994                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
adg  Ammonifex degensii
Pathway
adg00260  Glycine, serine and threonine metabolism
adg00750  Vitamin B6 metabolism
adg01100  Metabolic pathways
adg01110  Biosynthesis of secondary metabolites
adg01120  Microbial metabolism in diverse environments
adg01230  Biosynthesis of amino acids
Module
adg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeg_0107
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Adeg_0107
Enzymes [BR:adg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Adeg_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACX51282
UniProt: C9RAK5
Position
97437..98648
Genome map
AA seq 403 aa AA seqDB search
MEKSFLSHLECGRCGKEYEPEKPWQLCTCGGPLLARYDLGKIRSSVRKEDLARRAPNLWR
YREFLPVRKEENIVTLGEGMTPVLPLRRLGAAIGLPHLYLKDEGIIPTGTFKARGAAVGI
SRAKELGVKVLAMPTNGNAGGAWATYAARAGIRAVIVMPKDAPVITRNECAISGAELYLV
DGLISDAGKIVSRAVAERGWYDASTLKEPYRIEGKKTMGLEIVEQFDWQVPDVILYPTGG
GVGIIGIYKALQELQAVGWIGEKMPRLIAVQSSGCAPIVKAWQERKNESEYWENAYTIAF
GINVPKALGDFLVLKAIYETNGCAVAVSDEEILAAQRRLAREEGVFACPEGAATLAAAIR
LREQGWLHPYERVLLLNTGTGLKYPDTVEVSVPLLEKDQDLPN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagctttctgagtcacctggagtgtgggcgctgcggaaaggagtatgagcct
gaaaagccctggcaactctgtacgtgtgggggtcctctgttagcgagatacgatctagga
aagattcggtcatctgtaagaaaagaagatctggcgcgccgtgctcctaatctttggcgt
tatagagagtttttgcctgtaagaaaggaagagaatattgttactctgggagagggaatg
acacctgttttgcccttgcgccggttgggagccgcaataggtttgccacacctatactta
aaagacgaaggaatcattcctaccggcaccttcaaagctcgtggagcggcagttggcatt
tctcgagccaaggagttaggcgttaaagttcttgctatgcctaccaatggcaatgcaggt
ggagcgtgggctacttatgctgctcgggctgggatcagagctgtaattgttatgcccaag
gatgctccagtcataacgcgtaatgaatgcgctattagcggtgctgaactttatcttgtg
gacggtttaattagtgatgctggtaagattgttagtcgtgcagtagccgaaagaggttgg
tacgacgcttcaacacttaaggaaccttatcggatcgaaggtaagaaaaccatggggttg
gagattgttgaacagtttgactggcaagttcctgacgtgattctctatcccactggtgga
ggggtaggtattattggtatctataaagctttgcaggagttacaggctgtaggttggatt
ggggaaaagatgcctcgtttgatagcagtccagtccagtggttgtgctcctattgtaaag
gcttggcaagaacgcaagaatgaatccgaatattgggaaaatgcctatactattgctttt
ggtattaatgttcccaaagccctaggtgattttcttgtccttaaggcaatttacgagact
aacggttgcgctgtggcagtgagtgatgaggagattttggctgctcagcgaaggttagcg
agggaggaaggagtttttgcgtgtcctgagggagctgccactctcgctgctgcgatcagg
ctgagggaacaagggtggctgcatccttatgagagagttctgttattgaatacagggacg
ggcctaaagtatcctgatactgtggaggtcagcgtgcctttgctggagaaagaccaagac
cttcccaattag

DBGET integrated database retrieval system