KEGG   Ammonifex degensii: Adeg_0958
Entry
Adeg_0958         CDS       T00994                                 
Name
(GenBank) 3-oxoacyl-(acyl-carrier-protein) reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
adg  Ammonifex degensii
Pathway
adg00061  Fatty acid biosynthesis
adg00780  Biotin metabolism
adg01100  Metabolic pathways
adg01110  Biosynthesis of secondary metabolites
adg01212  Fatty acid metabolism
adg01240  Biosynthesis of cofactors
Module
adg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:adg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Adeg_0958
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Adeg_0958
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Adeg_0958
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:adg01004]
    Adeg_0958
Enzymes [BR:adg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Adeg_0958
Lipid biosynthesis proteins [BR:adg01004]
 Fatty acid synthase
  Component type
   Adeg_0958
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 AdoHcyase_NAD Epimerase
Other DBs
NCBI-ProteinID: ACX52093
UniProt: C9RCW6
Position
970857..971600
AA seq 247 aa
MKLGGKVALVTGASRGIGRAIAEALAASGAKVVINYLAREEEALQVVNGIKSAGGEAVAH
RADVAQAPEAQELVEFTVKHYGKIDILVNNAGITRDNLLLRMKDEDWDKVLAVNLKGAFL
TTRAAVRFMVKSRWGRIINISSVVGLSGNAGQANYAAAKAGLIGFTKALAKELGPRNITV
NAVAPGFILTDMTASLPEEVKQELLRRCALGRFGRPEEVAALVTFLASEEAGYITGQVIS
VDGGLSL
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaagctaggaggtaaagtagccctggtgaccggggcctcgcggggcatcgggcgggcg
atagccgaagccctggctgcttccggggccaaggtggtgattaattatctcgcccgggag
gaagaagcgctgcaggtggtgaatggcattaagagtgcgggtggggaggcggtggcacac
cgggccgacgtagcccaggcaccagaggcacaggaactggttgagttcaccgtaaagcac
tacggcaaaatagacatcctggtgaacaacgccgggataacgcgcgacaatctcctcttg
cgcatgaaggacgaggactgggacaaggtgctggcggtcaatctcaaaggggcttttctt
accacccgggcggcagtgcgctttatggtcaagtctcgctgggggcgcatcataaacata
agctcggtagtgggactcagcggcaacgcaggtcaggccaactatgcggcagccaaggcg
gggctcataggcttcaccaaggccctggccaaggagctgggaccccgcaacatcacggta
aacgcggtcgctcccggcttcatcctcaccgacatgacggcctccttgcccgaggaggtc
aagcaggaactcctgcgccgctgcgctctgggcaggttcgggcggccggaggaagtggcg
gcgctggtcacttttctggccagcgaggaggctggctacattaccggtcaggtcataagt
gtagacggcgggctttccctctaa

DBGET integrated database retrieval system