KEGG   Ammonifex degensii: Adeg_1821Help
Entry
Adeg_1821         CDS       T00994                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
adg  Ammonifex degensii
Pathway
adg00010  Glycolysis / Gluconeogenesis
adg00052  Galactose metabolism
adg00500  Starch and sucrose metabolism
adg00520  Amino sugar and nucleotide sugar metabolism
adg00521  Streptomycin biosynthesis
adg01100  Metabolic pathways
adg01110  Biosynthesis of secondary metabolites
adg01120  Microbial metabolism in diverse environments
adg01130  Biosynthesis of antibiotics
adg01200  Carbon metabolism
Module
adg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeg_1821
   00052 Galactose metabolism
    Adeg_1821
   00500 Starch and sucrose metabolism
    Adeg_1821
   00520 Amino sugar and nucleotide sugar metabolism
    Adeg_1821
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Adeg_1821
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Adeg_1821
Enzymes [BR:adg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Adeg_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACX52907
UniProt: C9R9C8
Position
complement(1814683..1815639)
Genome map
AA seq 318 aa AA seqDB search
MVDYVVGIDLGGTKIYTALATLDGKVRAEVKVPTQPEEGYRAVLERMAATVEEVKRQAGF
NHPPCRVGLGVPGPLDPVRGVVHVAPNLGWRDMPVKRDMEDILGVPVYLDNDANLAAWGE
YRFGAGRGTQHLIYLTVSTGIGGGLILEGKIYRGACCLAGEIGHMTLWPEGPRCHCGNYG
CLEALASGTAVAREARRLVAEGKGKGILAQAGGDPEAITAKTVGMAAAAGDAEALALFQE
VGRWLGIGLATLLNLLNPEVIVFGGGMMASSAFFWDTMVAEMQRRALPATASSVKLAKAE
LGGRSGVLGAVALALEPV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggtggattacgtggtgggaatagatctggggggaaccaagatctacaccgccttggcc
accttagatgggaaggtgcgggcggaagttaaggttcccacccagccggaggaaggctac
cgagcggtgcttgaacgcatggcggccacagtagaggaggtgaagcgccaggccggtttt
aatcatcccccctgccgggtgggactgggtgtccccgggcccttagatccggttcgagga
gtagtacacgtggcccctaacctgggctggcgggatatgcccgtcaagcgagacatggag
gacatcctgggggtccccgtttacctggacaacgatgccaacttagcagcgtggggagag
taccgcttcggagccggccggggaacccagcacctcatctacctgacggtgagcacgggc
attggtgggggtttgatcctggagggaaaaatttaccggggagcgtgctgcctggcgggg
gagattgggcacatgacgctttggcccgaagggccgcgttgccactgcggtaactacggt
tgtcttgaggctctggcttcggggacggcagtggcgcgggaggcccggcgactggtagcc
gaagggaaaggaaaggggatcctggcccaagcgggaggggatccggaggcgatcacggct
aagacagtggggatggcggcggcagctggagatgccgaggccttggccctcttccaggaa
gtagggcgctggctgggcatagggctggccaccctcctcaacctcttgaacccggaggtg
atagtttttggaggagggatgatggccagttctgccttcttttgggacacgatggtggca
gagatgcagcggcgggccctgccagccactgcttcttcggtgaagctggccaaggcggaa
ctgggaggccgttcgggagtgctcggggcggtggccctggccctggagcccgtctga

DBGET integrated database retrieval system