KEGG   Aeromonas dhakensis: CK627_03690Help
Entry
CK627_03690       CDS       T05186                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonic acid kinase
  KO
K11211  3-deoxy-D-manno-octulosonic acid kinase [EC:2.7.1.166]
Organism
adh  Aeromonas dhakensis
Pathway
adh00540  Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:adh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CK627_03690
Enzymes [BR:adh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.166  3-deoxy-D-manno-octulosonic acid kinase
     CK627_03690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kdo APH RIO1 Pkinase Kinase-like Choline_kinase Pkinase_Tyr
Motif
Other DBs
NCBI-ProteinID: ASX13388
Position
complement(738612..739325)
Genome map
AA seq 237 aa AA seqDB search
MQIQTEHNQICWYAEGAFRDPSPELFDPAWWQNNRQVVGTSIGRGVTWFVKDESRHLVLR
HYYRGGMVGKVVRDRFWFEGVESSRAMAEYSLLAKLSAQGLPVPRPFAARMAKQGPFYRA
DILIERIRGAKDLVALLKQGPIAGEVWHKVGQTVRRLHDAGVYHADLNSHNLLLDKEGKV
WVIDFDKGAIRSPGNWQQANLERLLRSFNKESQLHTSFHFVPENWQALMNGYQGKAS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcagaccgaacacaaccagatctgctggtatgccgaaggggcgtttcgcgac
ccttctcccgagctgtttgatccggcctggtggcagaacaaccggcaggtggtggggacc
tccatcggccgcggcgtgacctggttcgtgaaggacgagtcgcgccacctggtgctgcgt
cactactatcgcggcggcatggtgggcaaggtggtgcgggatcgcttctggttcgagggg
gtggagtctagccgggccatggccgaatacagcctgctggccaagttgagcgcccagggc
ttgccggtgccacgcccgtttgccgcccgcatggccaaacagggccccttttatcgcgcc
gacatcctgatcgagcgcattcgcggtgccaaggatctggtcgccctgctcaagcagggg
ccgatcgccggcgaggtgtggcacaaggtgggccagacggtgcgccggttgcacgatgcc
ggggtctatcacgccgatctcaacagccacaacctgttgctcgacaaggagggcaaggtg
tgggtgatcgacttcgacaagggggccatccgctcgcccggcaactggcagcaggccaac
ctggaacgcttgctgcgctccttcaacaaggagtcccagctgcataccagttttcacttc
gtgccggagaactggcaggccctgatgaacggctatcaaggaaaagcgagctga

DBGET integrated database retrieval system