KEGG   Aeromonas dhakensis: CK627_10195Help
Entry
CK627_10195       CDS       T05186                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
adh  Aeromonas dhakensis
Pathway
adh00230  Purine metabolism
adh00250  Alanine, aspartate and glutamate metabolism
adh01100  Metabolic pathways
Module
adh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:adh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CK627_10195
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CK627_10195
Enzymes [BR:adh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CK627_10195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ASX11124
UniProt: K1K8G6
Position
complement(2085106..2086362)
Genome map
AA seq 418 aa AA seqDB search
MSSIVVVGANWGDEGKGRIVDYLAGQAGASIRFQGGNNAGHTVVNDLGTFKLHQVPSGVF
NPDCLVVLGPGMVISPEKLTVELDEVKASGVTPKLAISDRATLCLPLHAMEDTLEEQRLG
DGAYGSTRQGIAPAYGDRVMKKAILVGWLKQPEVLVERIQFFLDWKLPQLKALYPTFEFN
QTAQEMADWLLEVSAPWIDSVCNVSMPLKALQAEGKTLLFEAQLGAGRDLIYGEYPWVTS
SHVSGAYAGIGGGLPGLRPERVIAVAKAFSTSVGTGTLLTAMENQDEFRKIANEFGATTG
RPRDVGYFDAVATKNGVELQAANEVALTKLDCLTGLPDLKICVAYEGAHTENPIWPQTAG
LKPVYEVMESWSEDITGCRTFAELPKAAQQYVLRIEELLGVPVPMVSVGPGRDEMILR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctatcgtagtcgtaggtgccaactggggtgatgaaggcaaaggccgcatcgtg
gattatctggcaggccaagccggcgccagcattcgcttccagggcggcaacaacgccggc
cataccgtcgtcaacgaccttggcaccttcaagctgcaccaggttccgagcggtgtgttc
aacccggattgcctggtcgtgctgggcccgggcatggtgatcagccccgagaaactgacc
gtcgagctggacgaagtgaaagcctccggcgtcactcccaagctggccatctctgatcgc
gccaccctctgcctgccgctgcacgccatggaagacaccctggaagagcagcgcctgggc
gatggcgcctacggctccacccgtcagggcatcgctcccgcctatggcgatcgcgtcatg
aagaaagcgatcctggtgggctggctgaagcagccggaagtgctggtcgagcgcattcaa
ttcttcctcgactggaaactgccgcagctcaaagcgctctacccgaccttcgaattcaac
cagaccgcccaggagatggccgactggctgttggaagtgtccgcaccctggatcgactca
gtctgcaacgtcagcatgccgctcaaagcgctgcaggccgaaggcaagaccctgctgttc
gaagcccagctgggcgccggccgtgacctgatctacggcgaatacccctgggtgacctcc
tcccacgtttccggcgcctatgccggcatcggtggcggcctgccgggtctgcgtcccgag
cgcgtcatcgccgtcgccaaggcgttcagcacctccgtcggtaccggcaccctgctgacc
gccatggagaaccaggacgagttccgcaagatcgccaacgagttcggcgccaccaccggc
cgtccccgcgacgtcggctacttcgacgccgtcgccaccaagaacggtgtcgagctgcag
gcagccaacgaagtggcgctgaccaagctggactgcctgaccggtctgccggatctgaag
atctgcgtcgcctacgaaggtgcccacaccgagaacccgatctggccgcaaactgccggt
ctgaagccggtttacgaagtgatggaaagctggagcgaagacatcaccggctgtcgtacc
ttcgccgagctgcccaaagcggctcagcagtacgtactgcgcatcgaagagctgctgggc
gtaccggttccgatggtctccgtcggcccgggccgtgacgagatgatcctgcgctaa

DBGET integrated database retrieval system