KEGG   Aeromonas dhakensis: CK627_14665
Entry
CK627_14665       CDS       T05186                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
adh  Aeromonas dhakensis
Pathway
adh00230  Purine metabolism
adh01100  Metabolic pathways
adh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:adh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CK627_14665
Enzymes [BR:adh01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CK627_14665
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ASX11931
Position
3135057..3137375
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSNIAHGKVLSIDASEALALHGV
EAVFTHEDVPTTCFRTAGHAWSLDEAKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AAALVKVTYEPLPVMTDAASALAEGACPIHPTGNLLRQSQIRAGEPEQAIAAADLQFKGH
YQTPVVQHCHLETVTCYAYMDQPDHIIVVTSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSYKLGGVPVKVTLSREECFFASRTRHGFAIDGTLGISRDGV
LKGYQLDVLSNTGGYASHGHSIASAGANKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVVFALECMLEDACAELGLDPLEVRIANVAREGDVNQVNQKTIYSAGLPECLRRGGEQ
FEWERLKAECLAQDPASRVRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDMGSLALIDGYVVLAGAPDKVLISVAEVSVNAYYHLTIGGQIT
SEVSHKTTTNPPSFGCTFVDLSVDIDLCKVTINRILNLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDAKSGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFRAFVAAGLIGEGSGEEQRHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctacaccgacgacaacatcatgctcggcatgcgccacgccaagtacgtgcgaagcaac
atcgcccacggcaaggtgctctccatcgacgccagcgaggcgctggccctgcacggggtc
gaagccgtgttcacccacgaggatgtgcctaccacctgctttcgcaccgccggtcacgcc
tggtccctcgatgaggccaagcgggatgtgaaagaccgccgcctgctcaccgatcatgtg
cgtcacttcggcgatggcgtcgccatagtcgtggcccgcgatccgctggttgccgagaag
gccgccgccctggtcaaggtgacctacgagccgctgccggtgatgacggatgcggccagt
gccctggccgagggggcctgtcccatccacccgaccggcaacctgctgcgccagagccag
atccgggcgggtgagccggagcaggccatcgccgccgccgacttgcagttcaagggacac
taccagacgccggtggtgcagcactgtcatctggagacggtgacctgctacgcctacatg
gatcagccggaccacatcatcgtcgtcaccagcacccagatcccccagattgtgcgcagc
cgggtggccaagtccctcggcctgccctggtccagcgtgcgggtgatcaagccctacatg
ggcggcggttttggcaacaagcaggatgtgctggaagagccgatggcggcatttttgagc
tacaagctcggtggcgtgccggtcaaggtgaccttgagccgggaggagtgtttctttgct
tctcgtacccgccacggttttgccatcgacggcaccctcggcatcagccgggatggcgtg
ctcaaggggtatcagctcgacgtgctctccaacaccggcggctatgcctcccacggccac
tccatcgccagcgccggcgccaacaaaataagctacctctatccgcgcagcgcctttggc
tatgatgccaaaaccttctacagtaacctgcccaccgccggtgccatgcgcggttacggc
gcgccccaggtggtgtttgccctcgaatgcatgctggaagacgcctgcgccgagctgggt
ctggatccgctcgaagtgcgcatcgccaacgtggcccgcgaaggggacgtcaatcaggtc
aaccagaagaccatctacagcgcggggctccctgagtgcctgcgccgtggcggcgagcag
ttcgagtgggaacggctcaaggccgagtgtctggcgcaggatccggcgagccgggtacgg
cgcggcatcggggtggcctgtttcagttatggatccaacacctatccggtgggggtcgaa
attgccggcgcccgcatgctgctcaatcaggatggcaccgtcaatctgcagatcggcgcc
accgagatagggcaggggtcggataccgtgtttgcccagatggcggcccagaccttgggc
attccgtttgagcagatccgggtcatttcgacccaggataccgacatcaccgcctacgat
ccgggttcgttcgcctcgcgccagagctatgtggcggcccccgccatccatcaggcggcg
ctgcagctgcgggcgcgcatcctctcgctggcggcccagctctgccatcaggatatggga
tcgctcgctctgatcgacggttacgtggtgctggccggtgcgccggacaaggtgctcatc
agcgtcgccgaggtatcggtcaacgcctactaccacctcaccatcggtggccagatcacc
tccgaggtctcccacaagaccaccaccaacccgccgagctttggctgcaccttcgtcgat
ctcagtgtcgacatcgatctctgcaaggtgaccatcaaccgtattctcaacctgcacgat
gcgggcaagatcctcaacccgcagctggcagaggggcaggtgcacggcggcatggggatg
gggatcggctggtccctgttcgaggagatgatcatcgacgccaagagcggcgtggtgcgc
aaccccaacctgctcgactacaagttccccaccatgctggatttgcccgaacttgagtgc
gacttcgtgcagacctacgagccccagtcggtctatggccacaaatccctgggggagcca
cccatcatctcgccgggcccggcgatccgtaacgccattcgcatggcgaccggtgtggcc
atcaacgagctgcccatcacccccaagaccctgtttcgggcgtttgtcgcggcgggtctg
attggcgagggatcaggggaggagcaacgccatgtttga

DBGET integrated database retrieval system