KEGG   Aeromonas dhakensis: CK627_14675
Entry
CK627_14675       CDS       T05186                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
adh  Aeromonas dhakensis
Pathway
adh00230  Purine metabolism
adh01100  Metabolic pathways
adh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:adh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CK627_14675
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ASX11933
Position
3138243..3138728
AA seq 161 aa
MMQPQSCPAVEIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVN
GTAIDSCLYLAVWADGKSIRTVEGERKGNELSDVQQAFIEEGAVQCGFCTPGLVMASAAL
LDKTERRPLTDAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccgcggtggagatccagtgcgagatcaacggaaaaccc
tactcctatgcggtgtcgcctaccatgtcgctgcttcacttcctgcgcgggcaggggctg
atcagcgtgaaagaggggtgcagtgtcggtgagtgcggcgcctgtaccgtgcgggtgaat
ggcacggctatcgacagctgcctctatctggcggtgtgggctgatggcaaatccattcgt
accgtggagggagagcgcaaggggaacgaactctccgacgtacaacaggcctttatcgag
gagggggcggtgcagtgcggtttttgtacccctggtctcgtgatggcgagcgccgccctg
ctcgacaagaccgagcgccgtccgctgaccgatgcggagatccgccgcgggctgtcgggc
aatctctgccgttgtaccggctaccagaacgtggtgcgggcggtgaagaagtgctgcaag
gggtga

DBGET integrated database retrieval system