KEGG   Aeromonas dhakensis: CK627_21325Help
Entry
CK627_21325       CDS       T05186                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
adh  Aeromonas dhakensis
Brite
KEGG Orthology (KO) [BR:adh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:adh03009]
    CK627_21325
Enzymes [BR:adh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CK627_21325
Ribosome biogenesis [BR:adh03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CK627_21325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_11 Methyltransf_12 Methyltransf_4 Methyltransf_32 TPMT MTS
Motif
Other DBs
NCBI-ProteinID: ASX13149
Position
4607862..4608662
Genome map
AA seq 266 aa AA seqDB search
MHLQCPICRSPLQLHDASKGRYCANKHHFDPAPEGYLDLIPGKKNPKDSDSRALMRAKRH
FLEQGHQLPLVEAMASLLSPLEPRELIHLGCGEGYYCRALAERLPGWQFAGVDIAKNTIF
AANKAQPEGQFVIADPARAPIMPGTAQLLLVNDLKVKTELLVNWLAPGGYLLYLQPGPRH
QWQLRVSLNPVSMEHPLSWPSLAGLDPMGQLRCQFSMQMDQGLREHILETSRLGWRASGE
QRHAFTHQGPDALEQDLLLSLWQKPL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttcaatgccccatttgccgcagcccccttcagctgcatgacgcctccaagggg
cgctactgcgccaacaagcaccacttcgatcccgccccggaaggctatctggatctcatc
cccggcaagaagaatcccaaggacagcgacagccgcgccctgatgcgcgccaagcgccac
ttcctggaacagggccaccagctgccgctggtcgaggcgatggccagcctgctctccccc
ctcgaaccgcgcgagctgatccacctgggctgcggcgaaggctactactgccgcgccctg
gccgaacggctgccgggctggcagtttgccggcgtcgacatcgccaagaacaccatcttc
gccgccaacaaggcgcagccggaaggccagttcgtcatcgccgatccggcccgcgccccc
atcatgccgggcacggcccagctgttgctggtcaacgatctcaaggtcaagaccgagctg
ctggtcaactggctggcaccgggcggctacctgctctacctgcaaccggggccgcgccat
cagtggcagttgagggtcagcctcaacccggtcagcatggaacacccgctgagctggccg
agcctggccggcctcgaccccatgggtcagctgcgctgccagttcagcatgcagatggat
cagggcctgcgcgagcacattctggagaccagccgcctcggctggcgggccagcggcgag
cagcgtcacgccttcacccaccaggggccggacgcgctggagcaggatctgctgctgagc
ctgtggcaaaagccgctgtga

DBGET integrated database retrieval system