KEGG   Alcanivorax dieselolei: B5T_00004Help
Entry
B5T_00004         CDS       T02259                                 

Gene name
gyrB
Definition
(GenBank) DNA gyrase subunit B
  KO
K02470  DNA gyrase subunit B [EC:5.99.1.3]
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:adi03032]
    B5T_00004 (gyrB)
   03400 DNA repair and recombination proteins [BR:adi03400]
    B5T_00004 (gyrB)
Enzymes [BR:adi01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     B5T_00004 (gyrB)
DNA replication proteins [BR:adi03032]
 Prokaryotic Type
  DNA Topoisomerases
   B5T_00004 (gyrB)
DNA repair and recombination proteins [BR:adi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      B5T_00004 (gyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB DNA_gyraseB_C HATPase_c Toprim HATPase_c_3 UFD1
Motif
Other DBs
NCBI-ProteinID: AFT68293
UniProt: K0C716
Position
3807..6221
Genome map
AA seq 804 aa AA seqDB search
MAENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNSIDEALAGYCSEI
KVIIHPDESVSVTDNGRGIPVDVHSEEGISAAEVIMTVLHAGGKFDDNSYKVSGGLHGVG
VSVVNALSETLKLTIRRHGKVHEQVYHDGVPEKPLDVVGTTESSGTTIRFRPSPATFNNI
QFHYDILAKRLRELSFLNSGVRIHLLDERSGDEDVFEYEGGLSAFVTYLNQNKSSLNQVF
HFQVDREDGIGVEVAMQWNDSYQENIYCYTNNIPQRDGGTHLAGFRAALTRTLNTYMEKE
GFLKREKANPSGDDAREGLTAVISVKVPDPKFSSQTKDKLVSSEVKSAVEQTMTERFQDF
LLEHPVESKNIVQKIIDAARARDAARKAREMTRRKGALDIAGLPGKLADCQEKDPALSEL
YIVEGDSAGGSAKQGRDRKYQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGR
DEYDADKLRYHRIIIMTDADVDGSHIRTLLLTFFFRQMPELIVRGHIYIAQPPLYKVKKG
KQETYIKDDPALDEYLTTLALDKAALYPGNEAPPISGEPLSNLIGEYRKVMKLVERQSRV
FPAQVLEEMIYLPSIDESKLEDEAFMVDWCAKLQARLANLGNNIQKFIISAEKDMERGLF
LPGVRVLAHGIVREYQVTLDFLESPDYQSIARLGETLEGLLADDAKVVRGEASRPIRDFA
EAMLWLMQQARRGINVQRYKGLGEMNADQLWETTMDPESRRMLQVTVEDAIAADQIFTTL
MGDDVDPRRQFIESNALYVSNLDI
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaacagctacgattcatccagcatcaaggttctcaagggcctggatgccgtt
cgcaagcggcccggcatgtatattggcgatacggatgacggcaccggcttgcatcatatg
gtcttcgaggtcgtggataattccatcgatgaggccctggccggctactgtagcgagatc
aaagtcatcattcatcctgatgaatccgtttcagtcacggataatgggcgcggtattcct
gttgatgtccattcggaggaaggtattagtgcggccgaagtaattatgacggtgctgcac
gccggtggaaaatttgatgacaactcctacaaggtgtccggtggacttcacggagtaggg
gtttccgtagtgaatgccctgtccgaaaccctgaaactgactattcgtcgtcatggcaag
gtgcatgagcaggtataccacgatggggttccggaaaagccactggacgtagtggggaca
acggaaagcagcggtacgaccatccggttccggccttctcccgccaccttcaataatatt
cagtttcactacgatatcctggctaaacgcctgcgagaactgagtttccttaattccggt
gttcgtatccatctgctggatgaacgtagcggtgatgaggatgtgttcgagtatgaaggc
ggtctcagtgccttcgttacttatctgaaccagaacaagagctcgctgaatcaggtgttt
cacttccaggtggatcgtgaagatggcatcggcgtggaagtggcgatgcagtggaacgat
tcctatcaggaaaacatctactgctacaccaataatattccgcagcgggacggcggcacc
catctggccggatttcgggcggctctgacccgaaccctgaatacctatatggagaaagaa
ggcttcctgaagcgggagaaagccaatccttccggtgatgatgcccgggaagggctgacc
gcggttatttcggtgaaggtgcctgatcccaagttctccagccagaccaaggataaactg
gtgtcctcggaggtgaaaagcgccgtcgaacagaccatgacggagcgtttccaggacttt
ctcctggaacacccggtcgaatccaagaatattgttcagaagattatcgatgcagcccgg
gcccgggatgccgcacgtaaggccagggaaatgacccgccgtaaaggggctctggatatc
gccgggctacccgggaagctggcggactgccaggagaaagaccccgctctatccgagctg
tatattgtggagggcgattccgcgggcggttccgccaaacagggccgtgaccgtaagtac
caggccatcctgccattgaagggtaagatcctgaatgtggagaaagcccgctttgacaag
atgctctcttcccaggaggtggcgacgctgatcacggcgttgggctgtggtatcggccgg
gatgagtatgatgcggataagcttcgctatcatcgcattatcatcatgacggatgcggac
gtggacggttctcacatccgtaccctgcttttgacgttcttcttccggcagatgccggaa
ctgattgtccggggccacatttatattgcccagcctcctctctataaggtgaaaaagggt
aagcaggaaacctatatcaaagatgaccctgccctggatgagtatctcactactctggct
ctggataaggccgcgctctaccccggcaacgaggcgccgccgattagtggcgagcctctg
tccaacctgattggcgaataccggaaggtcatgaagctggtggaacgccaatcacgggta
ttcccggcccaggtgctggaagagatgatttatctgcccagcatcgatgagagcaagctg
gaagatgaggctttcatggtggactggtgcgctaaattgcaagcgcgcctggccaatctt
gggaataacatccagaagttcatcattagcgccgagaaagatatggagcggggcttgttc
ttgccaggtgtgcgagtgctcgctcacggcatagtccgcgaatatcaagtcactctggat
tttctggagtcgccggactatcaaagcatcgcgaggctgggggaaacgctggaaggcctg
ctggccgatgacgccaaggtggtgaggggcgaggcaagccgtccgattcgggatttcgcc
gaggcgatgctatggctgatgcaacaggcccgtcgtggtattaacgtacagcgctataaa
ggcctgggcgaaatgaacgctgatcaattgtgggaaaccaccatggatccggagtcccgt
cgtatgttgcaggtaacagtggaagacgccatcgcggcggatcagatcttcactactctg
atgggcgatgatgtggacccccggcgtcaattcatcgagtccaacgccttgtacgtatcc
aacctggatatttga

DBGET integrated database retrieval system