KEGG   Alcanivorax dieselolei: B5T_00005Help
Entry
B5T_00005         CDS       T02259                                 

Gene name
hns
Definition
(GenBank) DNA-binding protein H-NS
  KO
K03746  DNA-binding protein H-NS
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:adi03036]
    B5T_00005 (hns)
   03400 DNA repair and recombination proteins [BR:adi03400]
    B5T_00005 (hns)
Chromosome and associated proteins [BR:adi03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HNS (histone-like nucleoid structuring protein)
    B5T_00005 (hns)
DNA repair and recombination proteins [BR:adi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      B5T_00005 (hns)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone_HNS SIMPL KHA PhnI DUF87 HTH_26 Remorin_C Ku_C
Motif
Other DBs
NCBI-ProteinID: AFT68294
UniProt: K0C4Q2
Position
complement(6321..6683)
Genome map
AA seq 120 aa AA seqDB search
MTINIDDLSVAELEKLIKQAERKLEKKRREAVKNAQAEIEKIAKDLGVSVEDLLDEKTTG
RKKVARKATRKKTKAAVRKPAKIKYRNPADSSQTWTGRGKRPVWLREALEKGGKLEDYEV
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgactattaatattgacgacctttccgtcgctgaattggaaaagctgatcaagcaggcg
gaaagaaaactggaaaagaaacgccgggaagcggtgaaaaacgctcaggcggaaatcgag
aagatcgccaaggatttgggcgtttccgttgaagatcttcttgacgagaaaaccaccggt
cgtaagaaggttgctcgcaaagccactcgcaagaaaaccaaggcggccgtccgtaagccg
gccaagatcaaataccgtaatccggcggacagttctcagacctggaccggccgcggtaag
cgccctgtatggctgcgagaggcgttggaaaaaggcggcaagctggaagactacgaggtc
tga

DBGET integrated database retrieval system