KEGG   Alcanivorax dieselolei: B5T_00006Help
Entry
B5T_00006         CDS       T02259                                 

Gene name
plsC
Definition
(GenBank) Acyltransferase domain protein
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00561  Glycerolipid metabolism
adi00564  Glycerophospholipid metabolism
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    B5T_00006 (plsC)
   00564 Glycerophospholipid metabolism
    B5T_00006 (plsC)
Enzymes [BR:adi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     B5T_00006 (plsC)
Lipid biosynthesis proteins [BR:adi01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   B5T_00006 (plsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-ProteinID: AFT68295
UniProt: K0C753
Position
complement(6751..7512)
Genome map
AA seq 253 aa AA seqDB search
MSGFPRDARVTWNIRVRSLLFFLLYNLAGIIHSVICVLIGPFLSFKKRHLLVNLWTRFAM
WLLQRLNGVRFKVEGREHLQGQAAVIISNHQSSWETFYLQLLVGPQATVLKRELLWLPFF
GWALALLKPIKIDRGKGRAALKAVVQQGEDRLRSNIPVVIYPEGSRQPPGSIGHFNSGGA
LLASRSGFPVIAISHNSGDCWPARSWLRLPGTITLRVSPPMDTRNKDAKTVTREVKHWIV
TNYPGELDKMDND
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatttccgcgtgacgcccgggtgacctggaatatccgggtacgcagcttgttg
tttttcctgctctataacctcgccggtattattcacagcgttatctgtgtattgatcggc
ccatttctgtcgttcaagaaaagacatctcctggttaacctctggacccgattcgccatg
tggctactgcagcggctcaatggcgtacgcttcaaggtagagggacgggaacacctgcaa
ggccaggccgcggtgattatcagcaaccaccagagcagctgggaaacgttttatctgcaa
ctattggtcggaccccaggccacggtactgaaaagagaactgttgtggcttccctttttt
ggttgggctctggcattgctaaaacccatcaaaatagatcgaggaaagggcagggcggct
ctgaaagcagtcgtgcaacaaggagaggaccgtctacgctccaatataccggtggttatt
tatcccgaggggtcacggcagccgccgggaagtattggacacttcaacagtggcggtgcg
ctgctggccagccgctccggttttccggtgatcgcgatcagccataatagcggcgactgc
tggccagcccgctcctggctgcgattacccggtactattaccctgcgggtgagtccgccg
atggatacccgcaataaagacgctaaaaccgttacccgggaggtaaaacactggattgtg
acgaattaccccggggaattggacaaaatggataacgattaa

DBGET integrated database retrieval system