KEGG   Alcanivorax dieselolei: B5T_00009Help
Entry
B5T_00009         CDS       T02259                                 

Definition
(GenBank) Polysaccharide deacetylase
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1 DUF2334
Motif
Other DBs
NCBI-ProteinID: AFT68298
UniProt: K0C718
Position
complement(8895..9818)
Genome map
AA seq 307 aa AA seqDB search
MDSAFAPLSHHGRFPYSAITQRRDFHWPEGKRLAVYIGFNVEHFAFGEGLGAKLGAVFNE
PDVLNYSWREYGNRVGAWRCLELFDQLEMPTGLITNTTLYDHCPDLLQAFQHRGDEVIAH
GHSNAYHQGTLSEEQETALLLHCRERIEKESGQVPKGWLSPWIGESHLTPDLLKETGYRY
TLNWSHDDQPVPMRTRNGGHLWAVPYPQEVNDIPMIIARKLDGSAFAQMIIDQFDEMLQQ
SDQQPLVMGIALHPYLVGQPYRLRHLRRALEHIQRHREAIWMTTPGRICDHMDTIMPPDQ
ERDQERE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggattctgctttcgctccgctgtcccaccatgggcgctttccttattcggccatcacc
caacgccgtgatttccactggcctgaaggcaaacggctggcggtgtacatcggtttcaat
gttgagcattttgctttcggggaagggctcggtgccaagctcggggcggttttcaacgaa
ccggacgtgctcaactactcctggcgtgagtacggaaaccgggtgggtgcgtggcgctgc
ctggaactgttcgatcagctcgagatgcccaccggtctgatcaccaacactaccctgtac
gatcattgccccgatctgttgcaggccttccagcatcgaggcgatgaggtcatcgcccac
ggccacagtaacgcctatcaccaaggcaccttgagtgaagagcaggaaacggcactgttg
ttgcattgtcgggagcgcatcgagaaagaatccggtcaggtccccaagggctggctgtcg
ccctggatcggagagtcgcatctgacgccggatctgttgaaggaaaccggctaccgctac
accttgaactggagccacgatgatcagcccgtgccgatgcgtacccgtaacggcgggcat
ctttgggcggtgccgtatccgcaggaggttaatgacatcccgatgatcatcgcccgcaaa
ctggacggcagcgcgttcgctcaaatgatcatcgaccagttcgacgaaatgcttcagcag
tccgatcagcaaccactggtaatgggcatcgcgctgcacccttatttggtcggacagccc
tatcgcctgcgccatctacgccgggctctggaacatatacagcgtcatcgggaggcgatc
tggatgaccacgccgggacgaatctgcgatcatatggacacgatcatgcccccggaccaa
gaaagggatcaggaaagggaatga

DBGET integrated database retrieval system