KEGG   Alcanivorax dieselolei: B5T_00011Help
Entry
B5T_00011         CDS       T02259                                 

Definition
(GenBank) ABC superfamily ATP binding cassette transporter, binding protein
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
adi  Alcanivorax dieselolei
Pathway
adi02010  ABC transporters
adi02024  Quorum sensing
Module
adi_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:adi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B5T_00011
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B5T_00011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:adi02000]
    B5T_00011
Transporters [BR:adi02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    B5T_00011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5
Motif
Other DBs
NCBI-ProteinID: AFT68300
UniProt: K0C755
Position
10415..11704
Genome map
AA seq 429 aa AA seqDB search
MTTKNKAICMPNLSVEQNGMPFALLSVSGGTAQTQQKGEAMLRAVKKWAVLVLCLMAGGT
LANEPVKIGLITALSGQSAQAGESITRGLQVAIDEINASGGVLDGRPLVLVRRDDEANPA
KGVVAARELIHKEKVAVLFGGLDTPVSMAIVPLVNQAKMPFVGPWAAGTPITKNGADPNF
VFRVSAMDEIVDIAMVEYAQKNFDARKFGLMMVNNPWGESNQKGLVAALKDKGLEPAASE
KFDGDQVDLVPQLTRLRDAGVDTICLVGNVGPSAQVVKSLRRMGWDVPVVSHWGPAGGRF
TELAGPGSEKVHFIQTYSFFGDQSPAGEKVIAALKAKYKDITGPEDITPAVGVANAYDAL
HLAALAINEAGSTEGEAIREGFFKIKQYQGLIKTYQQPFSPEVHDALSADDYVWARFIDN
RIVPVALSQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaaaaataaagcaatatgcatgcccaacctgagcgtcgaacaaaatggcatg
ccctttgcgttgttatcggtgtcgggcggaaccgcccaaactcagcaaaagggggaagcc
atgcttcgtgcagtaaagaaatgggccgtattggtactgtgcctgatggccggtggtact
ttggcgaacgagccagtgaagatcggattgatcaccgctttgtccggacagtccgcccag
gccggagagtcgatcacccgtggtctgcaggtggcgattgatgagatcaatgcttccggt
ggcgtactcgatggccggccgctggtgttggtgcgccgggatgatgaggccaatcccgcc
aaaggtgtggtggcggcgcgcgaactgatccataaggagaaggtggcggtcttgttcggt
ggcctggacaccccggtatccatggccatcgtgcctttggtcaaccaggcgaagatgccc
ttcgtgggaccctgggccgcgggcacgccgatcaccaaaaacggcgcggatcccaacttc
gtgttccgggtttcagcaatggatgagatcgttgatatcgccatggtggagtacgcacag
aaaaatttcgatgcgcggaagttcggcctgatgatggtgaacaacccctggggagaatcc
aaccaaaaagggctggtggccgcgctcaaggataaaggtctggaacctgcggccagcgag
aaattcgacggcgatcaggtggatctggtgccacaactgacgcgtctgcgcgacgctggt
gtcgataccatttgcctggtcggcaacgtcgggccttccgctcaggtggtgaaatccctg
cgtcgcatgggctgggatgtgccggtggtgtctcactggggccccgccggcggccggttc
accgaactggccggaccgggctctgaaaaagtgcatttcatccagacctacagtttcttc
ggcgaccaatctccagcgggagaaaaagtcatcgccgcactgaaagcgaagtacaaggac
atcactggcccggaagacattactccggcagtgggggtggccaatgcctacgacgccctg
catctggccgctctggccatcaacgaggccggctccaccgagggtgaagcgatccgggaa
ggtttcttcaagatcaagcaataccaaggtctgatcaagacctaccagcaacccttctcc
cccgaagttcatgatgccttgagcgccgacgactacgtctgggcccggttcatcgacaac
cggatcgttccggtggcgttgtcgcagtaa

DBGET integrated database retrieval system