KEGG   Alcanivorax dieselolei: B5T_00013Help
Entry
B5T_00013         CDS       T02259                                 

Definition
(GenBank) Inner-membrane translocator ABC transporter
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran BPD_transp_2 AAA_21 BCA_ABC_TP_C AAA_30 AAA_29 AAA_16 AAA_28 AAA_23 RsgA_GTPase AAA_22 AAA_15 AAA_33 MMR_HSR1 AAA_25 Zeta_toxin AAA_13
Motif
Other DBs
NCBI-ProteinID: AFT68302
UniProt: K0C9G1
Position
12599..15097
Genome map
AA seq 832 aa AA seqDB search
MKYPHLMMLAALVAVALVCTFSLNSYYVFVLANVALITIVGVGLNILLGLSGQISFGHVG
FYAIGAYTVAVLTTQAGWSFWPAWLAGALFSGVAGALVALPALRAKGPYLAMITIAFSFI
VQHAVIEMEGVTGGQNGIMGVMAPSLHESWSPEQNIAVLAVLTAAAMLLVYVLISRGTWG
AAMRAVKDSEVAAESVGINPLAAKTMAFALSALMAGLAGGLFAPLSGFVTPDTFSFMQSI
LFVLVVIIGGAGFIAGPVIGAIILGVLPELLASLESHRLLFFGGLLLVVLLVAPNGLMGW
LTAWKGRRSGDGDTDPLPASDVEPVLDTRLRHGLEVRGLSMTFGGVKAVSGLNLDVPAAA
VSSLIGPNGAGKTTVLNMLSGFYRPTDGGFSLTDIALQTEGAWRIARRGVARTYQTSQLF
DSLSVEENVALAACRGHLGTVLRGGPFRSRAVRQRARALLSFCGYHGDPALPASQLPHVD
RRLVEIARALALDPEVLLLDEPAAGLSREDTDRLGDLLTAVAAAGIAVLVVEHDMELVMS
VSDQVIVLDTGTLLAAGNAAEVQANPEVRKAYLGDSGDLLAAASRHPPQGPELLGVSRLV
AGYGAEPVLHGINLKIRQGEMVALLGANGAGKSTLMRVLSGLHPAQSGGVHLNGEVLNTM
PAEKIAGRGVVLVPEGRQVFPELSVLDNIRLGGFLHAEDREARVQGMLERFPRLRERQHQ
RAGLLSGGEQQMLALARGLMAKPRVLLLDEPSLGLAPKIIAELFEVLDQLRREDMTILLV
DQMAALALALADRAYVIEGGRVVAQGTADEIRANVDLANAYLGNAAPTPATG
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacccgcatttgatgatgctggctgcgctggtggcggtggccttggtttgcact
ttctccttgaacagctattacgtgttcgtgctggccaatgtggcgctgatcaccattgtc
ggcgtcggtctgaacattctgttgggtttgagtggacagatttccttcggccatgtgggg
ttttacgccattggcgcctacaccgtggcggtgctcaccacacaagcgggctggtcgttc
tggccggcctggttggcgggggcgctgttttccggcgtcgccggggctctggtggcgttg
ccggccttacgggccaaggggccttatctggcgatgatcaccatcgccttcagctttatc
gttcagcacgccgtgattgaaatggaaggggtcacaggtggtcagaacggcatcatgggg
gtgatggcgccctcgcttcatgagtcctggagccccgagcagaacatcgcggtgctggcc
gtgctgacggcagcggcgatgttgctggtttatgttttgatttcccgcggcacctggggc
gcggccatgcgggcggtcaaggacagcgaagtggcggcggaatccgtcggcatcaatcca
ctggcggcaaaaaccatggcgttcgcgctgtcggcgctgatggccgggttggccggaggc
ctgttcgcgcctctgtccggcttcgtaacaccggatactttcagtttcatgcagtccatt
ctgttcgtgctggtggtgattattggcggtgcgggattcattgccgggccggtgattggc
gccattattctcggtgtgttgccggaactgctggcgtccctggagtcccatcgcttgctg
ttctttggtggtctgttgctggtggttttgttggtggcgcccaatggtttgatgggctgg
ctgacggcctggaagggccgccggagcggggatggcgacaccgacccgctccccgccagt
gatgtcgaacccgtgctggatacgcgcctccgtcatggtttggaggtgcggggactgagc
atgaccttcggcggtgtcaaagcggtcagcggcttgaatctggatgtgccggcggcggcg
gtgagcagtctgattggccccaatggcgccggcaaaaccacggtgttgaatatgctcagc
gggttttaccggcccacggacggtggtttttcattgacggatatcgctctgcaaaccgaa
ggggcgtggcgcatcgcccgccgtggggtggcgagaacctaccaaacgtcgcagctgttc
gattcgctttccgtggaggagaacgtggctctggccgcctgccggggtcatttgggaacc
gtgctgaggggcggacctttccgttcccgggcggtacgccagcgggcacgcgccctgctg
tcgttctgtggctatcacggcgatccggccctgcccgcctcgcaattgccgcatgtggac
cggcgcctggtggaaatcgcccgggcattggcgttggatccggaagtgctgttgctggat
gagccggccgccggcttgtcgcgggaagataccgaccggttgggcgatctgctcacagcg
gtcgcggccgccggtatcgcggtcctggtggtggagcacgatatggagctggtgatgtcg
gtatccgaccaggtcattgttctggataccggtaccctgctggccgcgggcaacgccgct
gaggtacaggccaatccggaagtccgtaaagcttatctcggtgacagcggtgatctgctg
gccgcggcaagccgtcatcctccacaaggtcccgagctgctgggcgtcagccgcctggta
gcgggatacggtgccgagccggtgttgcacggtatcaatctcaagattcgccagggagaa
atggtggccctgttgggggccaacggcgccggcaaatccaccttgatgcgggtgctcagc
ggattgcatccggcccagagcggtggcgtgcatctcaatggcgaggtgctcaacaccatg
ccggcggagaaaattgccggtcggggtgtggtgttggtgccggaaggccgacaggttttt
cccgagttgtcggtgctggataacatccgccttggcggcttccttcacgccgaggaccgc
gaagcccgcgtgcaaggtatgctggaacggtttcctcgtctgcgcgagcgtcagcaccag
cgtgccgggctactctccggaggtgaacagcaaatgctggcactggcccgcggtttgatg
gcaaagccaagggttctgctattggatgagccgtctctcggactggcgccgaaaatcatt
gccgaattgttcgaggtgctggatcagctgcgccgggaggacatgaccattttgctggtg
gatcagatggcggcactggcattggctttggcggatcgagcctacgtgatcgaaggcggt
cgtgtggtagcgcaggggacggcggacgagatccgcgcgaacgtggatctcgccaacgcc
tatctgggcaatgccgcgcctactcctgcaacaggctga

DBGET integrated database retrieval system