KEGG   Alcanivorax dieselolei: B5T_00014Help
Entry
B5T_00014         CDS       T02259                                 

Gene name
glyS
Definition
(GenBank) Glycyl-tRNA synthetase beta subunit
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00970  Aminoacyl-tRNA biosynthesis
Module
adi_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:adi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B5T_00014 (glyS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:adi01007]
    B5T_00014 (glyS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:adi03016]
    B5T_00014 (glyS)
Enzymes [BR:adi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     B5T_00014 (glyS)
Amino acid related enzymes [BR:adi01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   B5T_00014 (glyS)
Transfer RNA biogenesis [BR:adi03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    B5T_00014 (glyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AFT68303
UniProt: K0C721
Position
complement(15078..17150)
Genome map
AA seq 690 aa AA seqDB search
MSRDLLIELGTEELPPKALPTLSAALTEEFVRQLDEAGLQHGEVERFAAPRRLAVLVRDL
DEKQADRDIERQGPAVQAAFDADGNPTKAAQGFAASLGLTVDQLDRQDTGKGERLIARIT
EEGKATIELVPAFFAQAIQKLPIPKRMRWGSRKVQFVRPAHWLVALFGEEVVPFELLDLQ
SGRTSYGHRFHAPSAIELSLAGEYAGRLEQEGHVIADFDRRKAMIEEQATAAGKQAGGTA
QINADLLDEVTALVEWPVALTGGFDQDFLRVPQEALISAMEEHQKYFSVLDADGKLMPKF
ITISNIQSKDPAQVIAGNEKVIRPRLADAAFFYDNDCKKTLAQHAEGLAQVVFQQQLGTV
ADKCQRIGRLASVIANHIGGDSAQARLAGELSKADLNSEMVYEFDTMQGIMGYYLARREG
QPEEVAEALYEQYLPRFAGDKLPQSKTGMAVSLADKIDTLVGIFGIGQKPSGTKDPYALR
RATLGVLRIIIENQLELDLRDLLDQAAAQLGERIDASQVDEAFDFIKGRYRAMYQEQGIA
TPVILSVLAIEDACRKPLDFDRRVKAVAAFQQREEAQALAAANKRVSNILAKLEQAPPEE
IDGALLEDEAEQELTNLVVAAYEQSEPLLEQGDYQAVLELLAELRAPVDAFFESVMVMAE
DPAVRDNRLALLSFLRDLFLNVADISLLQE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgggatttactgatcgagctgggcaccgaggaactgcccccgaaggcgttgccg
accctgagcgcggcgctcaccgaggagttcgtgcggcaactggacgaagccggactgcaa
cacggcgaggtggaacgcttcgccgcgccacgccggctggcggtgctggtgcgcgacctg
gacgaaaaacaggccgaccgtgatatcgaacgtcaggggccggcggtgcaggcggcgttc
gacgccgacggcaacccgaccaaggccgcccagggcttcgccgcttccctggggctgacc
gtggaccagctggaccgccaggacaccggcaagggcgaacgcctgattgcccgtatcacc
gaggagggcaaggccaccatcgagctggtgccggcattcttcgcccaggcgatccagaag
ctgccgattcccaaacgcatgcgctggggcagccgcaaggtacagttcgtgcgcccggca
cattggctggtggcactgttcggcgaggaggttgtaccgttcgagctgttggatctgcaa
tccggccgcaccagttatggtcaccgcttccacgcgccgagtgccattgaactgagcctg
gccggtgaatacgccgggcgcctggaacaagagggtcatgtgatcgccgatttcgaccgc
cgcaaggcgatgatcgaagagcaggcgaccgccgcgggcaagcaggccggcggtaccgcg
cagatcaatgctgatttgcttgacgaagtgaccgccctggtggaatggccggtggcgctg
accggcggcttcgatcaggacttcctgcgcgtgccccaggaagcgctgatcagcgccatg
gaagagcaccagaagtacttctccgtgctcgatgccgacggcaagctgatgccgaaattc
atcaccatcagcaatatccagtccaaggacccggcccaggtgatcgccggtaacgagaag
gtgatccgcccgcgcctggccgacgccgccttcttctatgacaacgactgcaagaagact
ctggcgcaacacgccgagggactggctcaggtggtgttccagcagcaactgggtacggtg
gccgacaagtgccagcgtattggccgcctagccagtgtcatcgccaatcatatcggcggc
gatagcgcccaggcccggctggccggcgagctgagcaaagccgacctgaacagcgagatg
gtgtacgaattcgataccatgcagggcatcatgggctactatctggcccgccgcgaaggt
cagccagaagaggtggccgaagcgctatacgaacaatacctgccccgtttcgccggcgat
aaactgccacaaagcaagaccggcatggcggtctccctggccgacaagatcgacacgctg
gtggggatcttcggtatcggccagaaacccagcggcaccaaggacccctatgccctgcgg
cgggccacgctcggtgtgctgcgcatcatcatcgaaaaccagctggaactggatctgcgg
gatctgctggatcaggccgccgcccagcttggtgaacgcatcgacgccagtcaggtcgac
gaggccttcgattttatcaagggccgttaccgcgccatgtatcaggaacagggcatcgcc
acaccggtgatcctgtcggtgctggccattgaggacgcctgccgcaaaccgctggatttc
gatcgccgggtgaaagccgtggccgcgttccagcagcgggaagaagcccaggctctggcc
gcggccaacaagcgggtctccaatattctggccaagctggaacaggccccgccggaagaa
atcgatggcgcgctgttggaagacgaagcggagcaggaactcaccaatctggtggtggcc
gcctacgaacagtccgagccgctgctggagcagggcgattaccaggcggtgctggaactg
ctggcggagctgcgcgccccggtggacgcgttcttcgaaagcgtgatggtgatggccgag
gacccggcggttcgcgataaccgcctggccctgctgagttttctgcgcgacctgttcctt
aacgtggccgatatcagcctgttgcaggagtag

DBGET integrated database retrieval system