KEGG   Alcanivorax dieselolei: B5T_00016Help
Entry
B5T_00016         CDS       T02259                                 

Gene name
tag
Definition
(GenBank) DNA-3-methyladenine glycosidase I
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
adi  Alcanivorax dieselolei
Pathway
adi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:adi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    B5T_00016 (tag)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:adi03400]
    B5T_00016 (tag)
Enzymes [BR:adi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     B5T_00016 (tag)
DNA repair and recombination proteins [BR:adi03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     B5T_00016 (tag)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_glyco HhH-GPD
Motif
Other DBs
NCBI-ProteinID: AFT68305
UniProt: K0C759
Position
18358..18924
Genome map
AA seq 188 aa AA seqDB search
MERCPWCGTDPLYVAYHDQEWGVPEHDDHRLFEFLLLEGAQAGLSWITVLRKRENYRRAL
DGFDPEKIARYGDRKLEQLLQDAGLIRNRLKMKAAVSNAQAYLDLREAGQTLDALLWGFV
DGTPRINRYRSVSEVPAVTPTAEAMSRELKKKGFRFVGPTIMYAFMQAAGLVNDHLISCP
RHRQLADG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggaacgatgcccctggtgcggtaccgaccccctgtacgtggcctaccacgaccaggag
tggggggtaccggaacatgatgatcaccgattgtttgaattcctgcttctggaaggagcg
caggccggcctcagctggatcacggtattgcgcaagcgcgagaactaccggcgtgccctg
gatggcttcgacccggaaaagatcgcccgctatggcgaccgcaagctggaacagctgctg
caggatgcgggactgatccgcaaccggttgaaaatgaaggcggcggtgagtaacgcccag
gcttatctggacctgcgtgaggcaggccagaccctggatgccctgctgtggggctttgtc
gatggcacgccgcggataaaccgctaccgatcggtatccgaagtgccggcggtcaccccc
accgccgaagccatgagccgggaactgaagaaaaaaggctttcgtttcgtcggtcccacc
attatgtacgccttcatgcaggccgccgggctggtaaacgaccatctgatcagctgtccg
cgtcaccggcagctggccgacgggtga

DBGET integrated database retrieval system