KEGG   Alcanivorax dieselolei: B5T_00017Help
Entry
B5T_00017         CDS       T02259                                 

Gene name
guaA
Definition
(GenBank) Class I glutamine amidotransferase, putative
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00230  Purine metabolism
adi01100  Metabolic pathways
Module
adi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B5T_00017 (guaA)
Enzymes [BR:adi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     B5T_00017 (guaA)
Peptidases [BR:adi01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   B5T_00017 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 GATase_3 RuBisCO_large
Motif
Other DBs
NCBI-ProteinID: AFT68306
UniProt: K0CA83
Position
19030..19755
Genome map
AA seq 241 aa AA seqDB search
MKPVLIIKAGSTYPELIEHYGDFEDWIARGLGDRCAVQVCDVREPVPLPSPDRIAAVIIT
GSHAMVTEQAPWMVRLTDWLDDAITHPAALPVLGICFGHQLLAKLLGGEVGDHPQGMELG
TVALRMASEAARDPLFAGLCQQPWGQMVHRQSVLVAPPEVSVLASNGHDACQAFRYRQRV
WGCQFHPEFNADITRAYLQALRGRSISDQRAADVMSEVRECPGANEVLSRFGQLVQDLCA
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggtgttgattataaaggccggcagcacctaccccgaattgatcgagcattac
ggggacttcgaggactggatcgcccgaggtctcggtgatcgctgtgccgtgcaggtatgc
gatgtgcgtgagccggtgccattgccgtcgccggaccgtatcgcggcggtcatcattacc
ggctctcatgccatggtgaccgagcaggcgccctggatggtgcgcctgaccgattggctg
gatgacgccatcacccatccggcggcgctgccggtgttggggatctgctttggccatcaa
ctgctggcgaagctgctcggcggtgaagtgggagaccatccacagggcatggaattgggc
acggtggcgctgagaatggcatcggaagcggcccgggatcccctgttcgccggactttgc
cagcagccctgggggcagatggtgcaccggcaatcggtgctggtggcgccgccggaagtg
tcggtgctggccagtaatggccatgacgcctgtcaggcgtttcgctaccggcaacgggtg
tggggctgtcagtttcatccggaattcaacgccgatattaccagggcctacctgcaagcc
ttgcgaggccggagtatcagtgaccagcgcgccgcggacgtcatgtccgaagttcgggaa
tgcccgggtgccaatgaggtattgagccggttcgggcagttggtacaggatctttgcgcc
gcctag

DBGET integrated database retrieval system