KEGG   Alcanivorax dieselolei: B5T_00019Help
Entry
B5T_00019         CDS       T02259                                 

Definition
(GenBank) Transcriptional regulator, TetR family protein
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WHG TetR_N HTH_23
Motif
Other DBs
NCBI-ProteinID: AFT68308
UniProt: K0C723
Position
20535..21143
Genome map
AA seq 202 aa AA seqDB search
MARRNQHSKEELRAMAIEALADLVEREGVDNFSVRQIAGKLGYTPGMLYHLFVNLDDLIL
HLNAQTLDALNARIDQAAGHGDPMAILKAMAFEYLRLAREHTALWQLVFSHRMANQAPVP
DWYVDRTRHMFEQVEVQLNNWVPAADQRQRQVMARTLWGSVHGICLLHVENKLNVAGDVA
PEAMLESLLDHYLSSCAREGEK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggcgtaaccagcacagcaaggaagaacttcgggccatggccatcgaggcgttg
gcggatctggtggaacgggaaggggtggataatttcagtgtgcgccagatcgccggaaaa
ctgggttataccccgggcatgctttaccacctgttcgtcaatctggatgatctgattctg
catctgaatgcccagaccctggatgcgctgaatgcccgcattgatcaggccgccggtcat
ggtgatccgatggcgatactgaaagccatggcgtttgaatatttgcgcctggcccgggag
cacaccgccctttggcagttggtgttcagccatcgcatggcgaaccaggccccggtgccg
gactggtatgtcgaccgtacccggcacatgttcgagcaagtggaagtccagctgaacaac
tgggtaccggcggcggatcaacggcaaaggcaggtgatggcaagaacactgtggggaagc
gtgcacggaatctgtttgctgcatgtggaaaataaactgaacgtggccggcgacgtggca
ccggaagcgatgctggaatcgctgcttgatcactatctgtcgtcatgcgccagggaagga
gaaaaataa

DBGET integrated database retrieval system