KEGG   Alcanivorax dieselolei: B5T_00024Help
Entry
B5T_00024         CDS       T02259                                 

Gene name
serA
Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain, putative
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00260  Glycine, serine and threonine metabolism
adi00680  Methane metabolism
adi01100  Metabolic pathways
adi01120  Microbial metabolism in diverse environments
adi01130  Biosynthesis of antibiotics
adi01200  Carbon metabolism
adi01230  Biosynthesis of amino acids
Module
adi_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    B5T_00024 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B5T_00024 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adi04147]
    B5T_00024 (serA)
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     B5T_00024 (serA)
    1.1.1.399  2-oxoglutarate reductase
     B5T_00024 (serA)
Exosome [BR:adi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B5T_00024 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 ACT AdoHcyase_NAD AlaDh_PNT_C IlvN
Motif
Other DBs
NCBI-ProteinID: AFT68313
UniProt: K0C725
Position
25916..27145
Genome map
AA seq 409 aa AA seqDB search
MAHTSLEKDKIRILLLEGIHQNAVDNLKANGYHNVELLPKALTGSDLTDAIKDAHFVGIR
SRTQLTEEVFAAAEKLIGVGCFCIGTNQVDLKAALKRGIPVFNAPYSNTRSVAELVIAHT
ISLMRGIPEKNAVAHRGGWLKSAKDSYEIRGKKLGIVGYGNIGAQVSVLAESMGMKVYFY
DVVPKLPLGNATQVQSLHDLLGMCDVTSLHVPDTPATRWMIKEEQIRAMKPKSYLINYAR
GKVVDIEALTAAIQDGHLLGAAIDVFPEEPKGNDDEFISPLREFDNVILTPHIGGSTHEA
QENIGTEVSEKLIRYSDNGSTLSAVNFPEVALPAHPDMHRLLHIHQNIPGILSQINTIFS
ENDINICGQYLQTNEDIGYVVIDVNKGYSQLALEKLRTIEGTIRTRVLF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggcccatacctctcttgagaaggacaagattcgcattctcctgctcgagggcatccac
cagaacgcggtggataatctgaaggcgaacggctaccacaacgtggagctactgcccaag
gccctgaccggcagcgatttgaccgacgctatcaaggacgcccatttcgtggggatccgc
tcccgcacccagctcaccgaagaggtgttcgcggcggcggagaagctgattggcgtgggt
tgtttctgtatcggcaccaaccaggtggatctcaaggcggcgctgaaacgcggcatcccg
gtgttcaacgcaccctactccaatacccgctcggtggcggagctggtgatcgctcacacc
atcagcctgatgcggggcattccggagaagaacgcggtggctcaccgtggcggctggctg
aagtccgccaaggacagttatgagatccgcggcaagaagctggggatcgttggctacggc
aatatcggtgcccaggtgtcggtgctggccgaatccatgggcatgaaagtgtacttctac
gacgtggtgccgaagctgccgctgggcaacgccacccaggtacagagtctccacgatctg
ctgggcatgtgtgacgtgaccagcctgcatgtaccggacaccccggctacccgctggatg
atcaaggaagagcagatccgggcgatgaagccgaagagctatctgatcaactatgctcgc
ggcaaggtggtggacattgaagcgctgaccgctgctatccaggacggtcacctgctgggc
gcggccattgacgtgttcccggaggaaccgaagggtaacgatgacgagttcatcagcccg
ctgcgggagttcgataacgtcatcctcacgccgcacatcggcggttccacccatgaagcc
caggaaaacatcggcaccgaggtgtccgagaagctgatccgctactcggataacggctcc
accctgagcgcggtgaacttcccggaagtggccctgccggcccatccggatatgcaccgc
ttgctgcatattcaccagaatatcccgggcattctcagccagatcaataccattttctcc
gagaacgatatcaacatctgtggtcagtatctgcagaccaacgaagatatcggttacgtc
gtgatcgacgtgaacaagggctacagccagttggccctggagaagctgcggaccatcgaa
ggcaccatccgcacccgggtgctgttctaa

DBGET integrated database retrieval system