KEGG   Alcanivorax dieselolei: B5T_00027Help
Entry
B5T_00027         CDS       T02259                                 

Definition
(GenBank) putative lipoprotein
  KO
K07337  penicillin-binding protein activator
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99993 Cell motility
    B5T_00027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpoB Nucleolin_bd DUF3280 CsgG TolB_N
Motif
Other DBs
NCBI-ProteinID: AFT68316
UniProt: K0CA91
Position
29000..29590
Genome map
AA seq 196 aa AA seqDB search
MRVVMAMMLGVALLASGCASKVEYGDPQARETVTPDFGSSDLQMIATKMVDDMMVFPPVA
ELTRNRRPVLFVDRVKNKTSEHVDTESITDTIQSRLINSGKFRFVDMTVVDRVRQQLEYQ
QDSGMVDQSTAAQMGRQIGAEFMLYGNLSSIVKRDNSTKDVYYKFTLKLLNIQSGIIEWS
GEKEIRKTRSRSLFGL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtagtgatggcgatgatgctgggagtggcgctgctggcaagcggttgtgcctcg
aaagtggaatacggcgacccccaggcgcgggagaccgtgaccccggatttcggctcctcc
gacctgcagatgatcgccaccaagatggtggatgacatgatggtgttcccgccggtggcg
gagctcacccgcaaccgccgcccggtactgttcgtggaccgggtcaagaacaagaccagc
gagcatgtggacaccgaatccatcaccgacacgattcagtccaggctgatcaactccggc
aagtttcgtttcgtcgacatgaccgtggtggaccgcgtgcgtcagcaactggagtaccag
caggactccggcatggtggatcagtccaccgccgcccagatgggacggcagatcggcgcc
gagttcatgctctacggtaatctgtcctccatcgtcaaacgggacaacagcaccaaggat
gtgtattacaaattcactctcaaactgctgaacatccagagcggcatcatcgaatggtcc
ggcgagaaggaaatccgcaagacccgcagtcgcagcctgtttggtttataa

DBGET integrated database retrieval system