KEGG   Alcanivorax dieselolei: B5T_00029Help
Entry
B5T_00029         CDS       T02259                                 

Gene name
kefB
Definition
(GenBank) Transporter, CPA2 family, putative
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    B5T_00029 (kefB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N
Motif
Other DBs
NCBI-ProteinID: AFT68318
UniProt: K0C727
Position
30953..32716
Genome map
AA seq 587 aa AA seqDB search
MEGFFVQALVLLGAAVLLLPLFQRLGLGSILGYLVAGVIVGPMGLAAIQGADRVLHFAEL
GVVLMLFVVGLELAPQQLWARRRQLMGMGVSQVVFSAALLTGFFLWWGEPTNAAIAIGAT
LALSSTAFAVQMLVETRQLGTPQGRGAFSILLFQDLAVIPLLLLLPALAGGAEGADKPNL
LIGFLALAGMVLAGRYLLNPWLGWLAKLHNRELMTATALLLVLSAAALMEMLHLSMGLGA
FVAGMLLANSPYREQLDTDIQPFKGLLLGLFFMAIGMTMDLRLLVQAPLDILAWGVALLA
LKTLVLMVIAKVSGNSWRGALLFGLLLSQGGEFAFVLFTQAGALGLLGSDDIGRLNLVVA
LSMAATPLLLKLVTRLWPEQRPSAALPEEPIPDNQEPQVVVAGFGRFGQIIGRILLSRNI
PFTALDTNPEHIDTVRRYGNQVYFGDVTRLDLLHHAGIGHARVVVLAVDGVEDSLRAAHL
ILEHFPKVTLIARARDRHHAYSLLALGVQHVVRETLESSLRASQAVLTQLGLPETTAIDL
VRTFREVDERLLREQVAHRDELEKLIELSARGREELQSLLSADREQE
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggaaggttttttcgtacaagcattagtgctgctgggcgccgcggtgttgttgttgcca
ttgttccagcgcctgggactgggcagcatcctcggttatctggtggccggcgtgatcgtg
ggaccgatgggcctggccgctatccagggcgcggatcgggtactgcatttcgccgaactg
ggcgtggtgttgatgctgttcgtggtgggcctggagttggcaccgcaacagctatgggcg
cggcggcgccagctgatgggcatgggtgtgagccaggtggtgttcagcgccgccctgctg
accggctttttcctgtggtggggtgagccgaccaacgccgctatcgccattggcgccacc
ctggcgttgtcctccaccgcctttgccgtacaaatgctggtggagacccggcagttgggc
accccccaggggcggggtgctttttccattctgttgttccaggatctggcggtgatcccg
ctgctgctgttgctgccggccttggccggtggcgcagagggcgcggataaacccaatctg
ctgatcggtttcctggcgcttgccggcatggtcctggccgggcgttatctgctgaatccc
tggctcggctggctggccaagctgcataaccgggaattgatgaccgccactgccttattg
ctggtcctgagtgccgccgccttgatggaaatgctgcatctttccatggggctgggcgct
ttcgtggccggtatgttgctggccaattcgccctatcgggagcagctcgataccgatatc
cagccgttcaagggactgctgctgggcctgttcttcatggccatcggcatgaccatggac
ctgcggctgctggtgcaggcgcccttggacatcctggcctggggtgtggcgctgctggcg
ctgaaaaccctggtgttgatggtgatcgccaaagtctccggcaacagctggcgtggcgcg
ctgctgttcgggctgctactcagccaaggcggtgaattcgcttttgtgctgttcactcag
gccggcgctctggggttattgggcagcgatgacattggccgcttgaacttggtggtggcg
ctgtccatggccgccaccccattgctgttgaaactggttacccggctctggccggaacag
cggcccagtgccgccctgcccgaagagccgattcctgataatcaggagccacaggtggtg
gtggccggattcggccgctttggccagatcatcggccgtattctgctgagccggaatata
ccgttcaccgcgctggacaccaatccggagcacatcgataccgtgcggcgttacggcaac
caagtgtatttcggcgacgttacccggctggatctgctccaccatgccggtatcgggcat
gcccgtgtggtggtgctggcggtggatggcgtggaggactcactgcgcgccgctcatttg
attctcgaacattttcccaaggtaacgctgattgcccgggcgcgggaccgccatcatgcc
tattccctgctggcgctcggggtgcagcatgtggtgcgggaaacgctggaatccagtctg
cgcgccagccaggcggtactgactcagcttggtctgccggagaccaccgccatcgatctg
gtgcgcaccttccgtgaagtggacgagcggctgctgcgcgaacaggtggcccatcgtgat
gagttggagaaactgatcgagctgtccgcccgtggacgcgaggaactgcagtccctgctc
agcgcggatcgggagcaggaatag

DBGET integrated database retrieval system