KEGG   Alcanivorax dieselolei: B5T_00030Help
Entry
B5T_00030         CDS       T02259                                 

Definition
(GenBank) hypothetical protein
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFT68319
UniProt: K0C4R6
Position
complement(32737..33423)
Genome map
AA seq 228 aa AA seqDB search
MAGVPVETHQSTVRLFLDHLARRESEAGWNLLSRESRALYPEIMAFTRQTSEQAELAADL
LADPNLTWTTRAVAPEAQVGVTTVSGETRREGMTDNMAFSWITRFQQGRLAIELPPQADD
TLYRWENPSGTGPGGLYQSDTPLTIAFPANEEGAGNGVERVHISLDQRLSVAPMTAMEKE
DDTIRYTFSPETLAPGPHVATVTWFDSELKIWYQSTAVFVVTAAPDPS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcgtgcccgtggaaacacatcagagcacggtgcgactgtttctggatcatctg
gcccggagggaatccgaagccggctggaatctgctcagccgggaaagccgggcgctttac
cccgagatcatggccttcacccgtcagacttcggaacaggcggaactggccgcggacctg
ctcgccgaccccaacctgacctggaccacccgggccgtggcgccagaagcccaggtcggg
gtgaccacggtatccggcgagacccggcgcgaggggatgacggataatatggcgttcagc
tggatcacccgtttccagcaaggacgtctggccatcgagctgccgccccaggcggacgac
accctttaccgctgggagaatccgagcggcaccggacccggcggtctttatcaaagcgac
acgccccttaccatcgcctttccggcaaacgaagagggggcaggcaatggcgtggagcgg
gtgcatatcagcctggaccagcgtctaagcgtggcgccgatgaccgcgatggaaaaagaa
gatgacactatccgctacaccttctcgccggaaaccctggcgcctggtcctcacgtggcc
accgtgacctggttcgatagcgaactgaagatctggtaccagagcacggcggtcttcgtc
gtcaccgccgccccggacccaagctga

DBGET integrated database retrieval system