KEGG   Alcanivorax dieselolei: B5T_00034Help
Entry
B5T_00034         CDS       T02259                                 

Gene name
coaD
Definition
(GenBank) Phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00770  Pantothenate and CoA biosynthesis
adi01100  Metabolic pathways
Module
adi_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    B5T_00034 (coaD)
Enzymes [BR:adi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     B5T_00034 (coaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Motif
Other DBs
NCBI-ProteinID: AFT68323
UniProt: K0C729
Position
complement(36608..37141)
Genome map
AA seq 177 aa AA seqDB search
MLGAPFQGQSEPNMTNRVVYPGTFDPITNGHKDLIERAAHMFDEVIVAVAASEKKRPLFT
LEERVGLVEECVQERGNVRVVGFSQLLAHFCQDQEANILLRGLRAVSDFEYEFQLANMNR
KLAPELETVFLTPAEHLSFISSSLVREIALLDGDVREFVPDNVAVALERRKKELAGE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcttggcgccccatttcaaggacaaagcgagccgaacatgaccaatcgcgttgtttac
ccgggcaccttcgatcccattaccaacggccataaagacctcatcgaacgggccgcccac
atgttcgatgaagtgatcgtggcggtggccgccagtgaaaagaaacgccccctgtttacg
ctggaagagcgcgtcgggttggtggaagaatgcgttcaggaacgcggtaacgtccgtgtg
gtcgggttttcccagctgctggcgcacttctgccaggaccaggaagccaacatcctgctg
cggggcctgagagcggtcagtgacttcgaatacgaattccagctcgccaacatgaatcgc
aagctggcgccggaactggaaaccgtgttcctcaccccggccgagcatttgtcctttatt
tccagttccctggttcgggaaatcgcgctgctggacggcgatgtcagggagttcgtgccg
gacaacgtggccgtcgcactggagcgtcgcaagaaagaactggccggcgaatag

DBGET integrated database retrieval system