KEGG   Alcanivorax dieselolei: B5T_00037Help
Entry
B5T_00037         CDS       T02259                                 

Definition
(GenBank) GMC oxidoreductase family protein, putative
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C FAD_binding_2 DAO FAD_binding_3 Thi4 NAD_binding_8 Pyr_redox_2 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AFT68326
UniProt: K0CA96
Position
complement(38699..40315)
Genome map
AA seq 538 aa AA seqDB search
MQDLSALPISGIKDLWKAGIAEGWHALDGQTITENRTLEADVIIVGTGAGGGVSAEILTQ
HGLKVILLEAGQLRSSDDFVLDEGKAYHDLYQEGAMRATKDAGMTILQGRTVGGTTVVNW
TSSFRTPRQTLDYWRDRFGVIDLDREALNPWFDRMEQRLNISKWAMPPNANNAVIKKGCE
KLGWHWGIIPRNVSGCWNIGYCGMGCPTDAKQSMLVTTLPAAMKKGATLLYSTRAERLLM
EGDKVVGVEARPLNQAKEPTGATLTLKARAVVVSGGGIQSPALLLRSQAPDPEKRIGKRT
FLHPTSFTFGRYQEEVAPYYGAPQSLYSDEFIFKYGVDGPGGYKLEMMPLHPGLASALIG
GIGEQAREEITGLPHLAASIALVRDGFHDNSEGGSVELRDNGEPVLDYPVNAYLLEAAKR
SHLAQVEMQFAAGAKAVRPGHSHAPYYRNWDDARQGIETLEYAPFITSLGSAHVMGGCAM
GNDEKYCLVNHDGSYKYLDNLYVIDGSVFPTSLGVNPQLSIYAISARNATALAEKLRA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatttatccgccttgccgatcagcggcatcaaggatctctggaaagccggtatc
gccgaaggctggcacgccttggatggccagaccatcacggaaaaccgcaccctggaagcc
gatgtgatcatcgtcggcaccggtgccggtggcggtgtcagcgcggaaattctcactcag
catggcctcaaggtcattttgctggaggccggccagttgcgcagctccgacgatttcgtt
cttgatgagggcaaggcctaccacgacctctatcaagagggggccatgcgcgccaccaag
gacgccggcatgaccatcctgcaaggccggaccgtgggcggcaccaccgtggtcaactgg
accagcagtttccgcacaccacgccagaccctggattactggcgtgatcgtttcggtgtc
atcgacctggaccgggaagcgctcaatccctggttcgaccggatggagcaacgcctcaac
atcagcaaatgggccatgccaccgaacgccaacaatgccgtgatcaagaaaggttgcgag
aaactggggtggcactggggcatcatcccgcgcaacgtcagcggctgctggaatattggc
tactgcggcatgggctgtcccaccgacgccaagcaatccatgttggtcaccacactgccg
gcggcaatgaagaaaggcgccaccttgctctacagcacccgcgccgagcggctgctgatg
gaaggcgataaggtcgtgggggtggaagcgcggcctttgaatcaggccaaggagcccacc
ggcgccaccctgaccctgaaagcgcgggccgtggtggtttccggaggcggcattcagagc
ccggcattgttgttgcgctcgcaggcgccggatccggaaaaacggataggcaagcgcact
ttcctgcatcccaccagtttcactttcggtcggtaccaagaggaggtggctccctactat
ggcgcgccccaatccctgtattccgacgagttcatcttcaaatacggcgtggacggcccc
ggtggctacaagctggaaatgatgccgctgcatccagggctggccagcgcgctcatcggt
ggcatcggcgaacaggcacgggaagagatcaccgggctgccgcatctggcggcctccatc
gcgctggtgcgcgacggcttccatgacaacagcgaaggcggctcggtggagctgcgcgac
aacggcgaacccgtgttggactacccggtgaatgcgtacctgctggaagcggcgaaacga
tcccatctggcccaggtggaaatgcagttcgccgccggcgccaaggcggtgcggcccggt
cactcccatgctccgtactaccgcaactgggacgacgcccggcaaggcatcgaaaccctg
gaatacgcgccttttatcacctccctgggcagtgctcatgtaatgggcgggtgcgccatg
ggcaacgacgaaaaatattgtctggtcaaccacgatggcagctacaaatatctggacaat
ctctacgtcatcgatggctcggtgttccccaccagtctcggggtcaatccgcaattgagc
atctacgccatcagcgcgcgcaacgccaccgccctggcggaaaagctccgggcctga

DBGET integrated database retrieval system