KEGG   Alcanivorax dieselolei: B5T_00038Help
Entry
B5T_00038         CDS       T02259                                 

Definition
(GenBank) Tat pathway signal sequence domain protein
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAT_signal
Motif
Other DBs
NCBI-ProteinID: AFT68327
UniProt: K0C9H2
Position
complement(40361..40882)
Genome map
AA seq 173 aa AA seqDB search
MDRRDFLKLSAGASVMLTAGSSLALLTGCSRNDGPAHGYRHLRSQDVTLLRPLAQVLLAP
ALVAADATADQALLAFDDLLDGGMPGTRGAVFELLDLLQLAPGRWYLTGTWKHFAEQTEE
QLSATLDHWSRSESELPRAAFRGLTQPFHMAWYVQPDAARTTGYPGPPNKIIS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtcgcgactttctcaaactcagcgccggcgccagtgtcatgctgacggcggga
tcaagcctggccctgttgactggctgcagccgcaacgacggtccggcccacggctatcgc
cacctgcgttcccaggacgtcaccttgctcaggccgctggcccaggtactgctggcaccg
gccctggtcgcggcggacgccaccgccgaccaggcgttgctggctttcgatgaccttctc
gatggcggcatgcccggcacccgtggcgcggtgttcgagttgctggatctgctgcaactg
gccccggggcgttggtacctcaccggcacctggaaacatttcgccgagcaaaccgaagaa
cagctcagcgcgaccctggatcactggtcacgcagcgaaagtgagctgccacgagctgcc
ttccgaggcctcacccagccgttccacatggcttggtacgtgcaaccggatgccgcgcgc
accaccggttatcccggcccgccgaacaagatcatcagctga

DBGET integrated database retrieval system