KEGG   Alcanivorax dieselolei: B5T_00040Help
Entry
B5T_00040         CDS       T02259                                 

Gene name
phaD
Definition
(GenBank) Transcriptional regulator, TetR family protein
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR TetR_N HTH_10 HTH_20 TetR_C_11 HrcA_DNA-bdg HTH_5 HTH_24
Motif
Other DBs
NCBI-ProteinID: AFT68329
UniProt: K0C4S0
Position
42508..43212
Genome map
AA seq 234 aa AA seqDB search
MTGTKTRILDTALDLFNRHGERNVTTNHIAEALGISPGNLYYHFRNKTAIVAALFERYRQ
QIWEWLPPPKGELTWQDKMHYLQGILESMWQGRFLHRDLPHFLHQDPELRAEYTQFVQDG
MERGLQIYQGLRASGLIEASDEDLRALMVNTWVLAMSWPGLTHGLNPAAAENETLDRALL
RQGIYQIVCLEAPYLRGEALNHLDAMKAEFRVGDTTVNLLFTASDPHVGEVSNG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgactggcaccaaaacgcgcattctggacaccgccctggacctgtttaatcgccacggc
gagcgcaatgtcaccaccaaccacatcgcggaggccctcgggatcagtccaggcaatctg
tactatcacttccgcaacaagacagcgatcgtggcggcgttgttcgaacgttaccgtcaa
cagatctgggaatggctgccgccacccaagggggaattgacctggcaggacaagatgcac
tacctgcaggggattctggagtcgatgtggcagggccggtttctgcatcgggatttgccg
cattttctccaccaggatccggagttgcgtgccgaatacacgcagttcgtgcaagatggc
atggagcgcgggctgcagatttatcagggattgcgcgccagcggtctgatcgaggccagc
gatgaggacctgcgtgccctgatggtgaatacctgggtactggcgatgtcgtggccgggc
ctgacccacggtctcaatcccgccgccgctgagaacgagaccctggatcgggcgctgttg
cgtcagggcatttatcagatcgtgtgcctggaagcgccctatctgaggggggaggctcta
aatcatctggatgccatgaaggcggaattccgggttggcgacaccacggtgaacctgttg
ttcacggcatccgacccccatgtcggggaggtgtcaaacggctga

DBGET integrated database retrieval system