KEGG   Alcanivorax dieselolei: B5T_00044Help
Entry
B5T_00044         CDS       T02259                                 

Definition
(GenBank) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00072  Synthesis and degradation of ketone bodies
adi00280  Valine, leucine and isoleucine degradation
adi00650  Butanoate metabolism
adi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B5T_00044
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    B5T_00044
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5T_00044
Enzymes [BR:adi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     B5T_00044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AFT68333
UniProt: K0C735
Position
47543..48856
Genome map
AA seq 437 aa AA seqDB search
MINKIWDSFESAVADVKDGDSVMIGGFGSSGFPLQLIEALRQHGARDLTVISNNAGVGDE
GIASLLKDRLVRKIVCSFPRSAGSVWFERLYEEGAIELELVPQGTLAERIRAAGAGIGGF
YTPTGYGTRLAEGKETKVIDGRGYVLETALPADVALIKAQRADAWGNLIYNTAGRNFNPP
MATAATLTVAEVERVEAVGDLDPECIVTPGIFVDRVVAQKEWRKMRLKPAEIAERVAQDI
PDGAYVNLGIGMPTMVANYVSDDRQVIYQSENGILGVGPAPAPGEEDPDLINAGKQFVTL
LPGGAYFDNAESFAMMRGGHLDLAVLGAFQVSEKGDLANWATNNDTYPPAVGGAMDLAVG
AKQVFVIMSHTTKSGEPKILESCNYPLTGAAVVKRIYTDLAVLDVTDEGLRVRQLHGDNT
FDEVQALTGATLLPAQN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaataaaatttgggattccttcgagtcggcggtggccgacgtcaaggatggcgac
tcggtgatgatcggcggcttcggcagttccggttttcccctgcaactgatcgaggccctg
cgccaacacggcgcccgggatctgaccgtgatctccaataacgccggggtgggtgatgag
ggcatcgcctccctgctgaaagatcgtctggtgcgcaagatcgtctgttcgtttccgcgc
tccgccggttcggtgtggttcgagcgcctctatgaagaaggcgccatcgaactggagctg
gtgccccagggcactctggcggaacggatccgcgccgccggtgccggcatcggcggtttc
tatacgcctaccggttatggcacccggctggccgaaggcaaggaaaccaaggtgattgac
ggccgcggctatgtactggaaaccgctttgcccgccgacgtggctctgatcaaagcgcaa
cgggcggatgcctggggcaacctgatttacaacaccgccggccgtaacttcaatccgccg
atggccaccgccgccaccttgaccgtggcggaagtggaacgggtggaagcagtgggcgat
cttgacccggaatgcatcgtcaccccgggtatcttcgtggatcgggtagtggcacagaag
gagtggcggaagatgcggcttaaaccggcggaaatcgccgagcgggtggcccaggatatt
cccgacggcgcctacgtgaatctgggcatcggcatgcccaccatggtggcgaactacgtc
agcgacgaccggcaggtgatctaccagagcgagaacggcatcctcggtgtcggcccggct
ccggccccgggcgaggaagacccggatttgatcaacgccggcaagcagttcgtcactctg
ctgcccggtggcgcctatttcgacaacgcggaatccttcgccatgatgcgtggcggtcat
ttggatctggcggtgctgggtgcgttccaggtgtcggaaaaaggcgacctggccaattgg
gccaccaataacgacacctacccaccggcggtgggcggcgccatggatctggcggtgggc
gccaagcaggtgttcgtgatcatgagccacaccaccaagagcggtgaaccgaagatcctg
gaaagctgtaactatccgctgaccggcgccgccgtggtgaaacgcatctacaccgatctg
gcggtgctggacgtcaccgacgaagggctgcgggtacgtcaattgcacggtgataacacc
ttcgacgaggtgcaggcactgaccggcgcgacgctgttgccggcgcagaactga

DBGET integrated database retrieval system