KEGG   Alcanivorax dieselolei: B5T_00046Help
Entry
B5T_00046         CDS       T02259                                 

Definition
(GenBank) Hydrolase, alpha/beta fold family protein
  KO
K07019  uncharacterized protein
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydro_lipase
Motif
Other DBs
NCBI-ProteinID: AFT68335
UniProt: K0C777
Position
complement(50332..51342)
Genome map
AA seq 336 aa AA seqDB search
MTPAAFRAPWWARSPHLQTLWGPLLRRTKALSRRRETLPLADGDHLLLDWCGPAPDGQRP
VLLLQHGLSGSSDSHYIIGIQRRLLALGLPSVAANGRGALVPNDTARSYHAGEIDDLDTV
IRHVHERAKGAPVLALGVSLGASRLLNWLAQADSGKLAGALAICAPLQLANSADHMDQGL
SRIYRNHLIKALLATLDAQERHLNKVNPEQAAILAGLDRTGIRSFWDFDGRIVAPLYGFR
DAADYYAQCSAGARLGAIGTPTWLLQARDDPFMTEASLPRQQDLSDAVMLEVAEHGGHVG
FVQGSIRRPHYWLEERAEVFIRAFSSNQQSVSTAAG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactcccgccgcttttcgggccccctggtgggcccgttccccccatctgcaaactctg
tgggggccgctattgcgccgtaccaaggcgctatcgcggcggcgggaaaccctgccactg
gcggacggcgatcacctgctactggactggtgcggaccggcaccggacgggcagcgcccg
gtattgttgctccagcacggtctgtccggctccagcgattcgcactacatcatcggtatc
caacggcgtctgctcgccctgggcctgccttcagtggcagccaacggccgaggcgccctg
gttcccaatgacaccgccaggtcttaccacgccggggagatcgatgacctcgacacggtg
atcaggcacgtccatgaacgcgccaagggagcaccggtgctggcgctcggcgtttccctg
ggggcctcgcgcctgctcaactggttggcccaggctgattccggcaaactggccggcgcc
ctggcgatctgcgcgccgttgcaactggcgaacagtgccgaccatatggatcagggcctg
tcgcgcatctatcgcaatcatctgatcaaagccctgctcgctactctggatgcccaggaa
cggcatctgaacaaggtgaaccccgagcaagcggcgatcctggccggcctcgaccgcacc
ggcatccgctctttctgggattttgacggccggatcgtggcgcccttgtacggcttccgc
gatgccgccgactactacgctcaatgctccgccggggcgcgcctcggcgccattggcacg
cccacctggctgctgcaggcccgggacgaccctttcatgaccgaggccagcctgccccgg
cagcaggatctcagtgacgcggtgatgctggaagtggcggagcacggtggccatgtgggg
tttgttcagggttcgatccggcgccctcattattggctggaggagcgggccgaggttttc
atccgcgcgttttcatcgaatcagcaaagcgtttccaccgctgccggctga

DBGET integrated database retrieval system