KEGG   Alcanivorax dieselolei: B5T_00048Help
Entry
B5T_00048         CDS       T02259                                 

Definition
(GenBank) Membrane protein, putative
  KO
K07340  inner membrane protein
Organism
adi  Alcanivorax dieselolei
Brite
KEGG Orthology (KO) [BR:adi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    B5T_00048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NfeD Tetraspannin
Motif
Other DBs
NCBI-ProteinID: AFT68337
UniProt: K0C9H7
Position
complement(52315..52776)
Genome map
AA seq 153 aa AA seqDB search
MPEYSYWIILGLILIIAEFLISGLLTIFLGLAAVIVGILVFFGVLNDLTWEITTFAVISL
LLLVGARRYLRAWLFGREAPSKSTEDSAGLTGARATVEQDFVDGIGAVRYRGARWQAQSP
VALKAGEMVRITKHDGLWLTVEPWSSTSTDKQP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgccggaatacagttactggatcattctcgggttgattctgatcatcgcggagttcctg
atctccgggctgctgaccatctttctcggtctggccgcggtgatcgtcggcattctggtg
tttttcggtgtcctcaatgacctgacctgggagatcaccaccttcgccgtcatcagcctg
ctattactggtgggggcgcggcgttatctgcgcgcctggctgttcgggcgtgaggcccca
tccaaatccaccgaggacagcgctggcctgaccggcgcccgcgccaccgtggagcaggat
ttcgttgacggtatcggcgcggtacgataccgcggcgcccgctggcaggcgcaatcgccg
gtagccttgaaggccggggagatggtgcgcatcaccaaacatgatggactttggctcacg
gtcgaaccctggtccagcacttcaaccgacaagcaaccgtaa

DBGET integrated database retrieval system